KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0122Help
Entry
NTHI0122          CDS       T00248                                 

Definition
(GenBank) conserved putative exported protein
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT
Motif
Other DBs
NCBI-ProteinID: AAX87109
UniProt: Q4QPD8
Position
109850..110608
Genome map
AA seq 252 aa AA seqDB search
MATNRLLKIVFSLIGLGVATHSVAFNGFGTDIDGYIKDASNRYQVDEAMLRGLVKIEDGW
YGNVSPTGATGVGQFTRGTWNWLATTDEGRALGMTQITRYNRDTPFDPRKNNQLNTLATA
LLARWHINQFFERGIKPSHENLYLAHNIGIDGLHRALQGRATREDILNMKRNGMKKGMSV
QGFLVYQSERFNVSKQIANFQRPSVSPRYQIENKPLPANLHWVSPTETAMRWVEPASNQT
NQQAIRWQNPTN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaatcgtctattaaaaatcgtatttagcttaatcggtcttggcgttgcgact
cactccgttgcatttaatggctttggaactgatattgatggctatattaaagatgcatct
aatcgctaccaggtcgatgaagcgatgctacgtgggttagtaaaaattgaagatgggtgg
tatggaaatgtttccccaaccggggcaaccggtgtggggcaatttacccggggcacctgg
aattggcttgcaacaactgatgaggggcgagccttaggtatgactcaaatcactcgttac
aatcgtgatacacctttcgaccctagaaaaaacaatcaacttaacactctagcaaccgca
cttttagctagatggcatattaatcagttttttgagcgaggcataaaaccatcccatgaa
aatttatatcttgctcataatatcggtatagatggtttacatcgagcgctacaaggtaga
gcaacacgtgaagatattctaaatatgaagcgtaacgggatgaaaaaaggaatgtcggta
caaggctttcttgtttatcaaagtgagcgttttaatgtcagtaaacaaatagctaacttc
cagcgcccttcagtatcaccacgttatcaaattgagaataaaccattaccagccaattta
cattgggtttctccaacagaaaccgctatgcgttgggttgagccagcgtcaaatcaaaca
aatcaacaagctattcgttggcaaaatccaaccaattaa

DBGET integrated database retrieval system