KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0123Help
Entry
NTHI0123          CDS       T00248                                 

Definition
(GenBank) conserved putative exported protein
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2859
Motif
Other DBs
NCBI-ProteinID: AAX87110
UniProt: Q4QPD7
Position
110624..111130
Genome map
AA seq 168 aa AA seqDB search
MQYKSFFLSLVCLGAVVQAQAELKVIGDFGGESAVRFYEALQPDESMVQAYPNSVPSTLT
EADILPVISHRMTPGQIQPVRMNLPGMLPIFLIGTDNLSKNWLHANYNYLKKIGAMGLVV
SVKTTNELSELRQLAPDLTLMPTPGDDLASRLNLAHYPALLTSEGLSQ
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcagtataaatcctttttcctctctttggtctgcttaggagcagtagttcaggcgcaa
gctgaattaaaagttattggtgattttggcggagaaagtgcagtccgtttttatgaagca
ttacaaccggatgaatcaatggttcaagcctaccctaatagcgttccttcaacattgacc
gaagcggatattttacctgttatctcacatagaatgacaccgggccaaatacaaccagtc
agaatgaatcttcctggaatgttgcctatttttcttattggaacagataacttatctaaa
aattggctacacgctaattataattaccttaaaaaaattggtgcaatgggacttgtagta
agcgttaaaacaacaaacgaattaagcgagttacgccaattagcaccggatttaacctta
atgccaacgccaggggatgacttagcttcaagattaaatcttgctcactaccctgcttta
ttgacttcagaaggattgtcgcaatga

DBGET integrated database retrieval system