KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0133
Entry
NTHI0133          CDS       T00248                                 

Definition
(GenBank) conserved putative lipoprotein
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
SSDB
Motif
Pfam: tRNA-Thr_ED
Other DBs
NCBI-ProteinID: AAX87119
UniProt: Q4QPC8
Position
118869..119276
AA seq 135 aa
MKVLMMMGVILAASSVLTGCSTSQGDLLPTGDATMKDIWNRGGNDSNITSYRTPNGRLID
APNYVSSREQQTYTRTAENEVKNLFPRLPNPDLVMYVYPHLTDSSEQMPVPGYSSVIPFY
GRVQYAQPGERTRMY
NT seq 408 nt   +upstreamnt  +downstreamnt
atgaaagttttaatgatgatgggcgtgattttagccgcaagcagtgttttgactggctgc
tcaacttctcaaggtgatttattgccaacaggcgatgcaacaatgaaagatatttggaat
cgaggcggtaatgatagcaatattacatcttatcggacaccgaatggccgtcttattgat
gcaccaaattacgtttcatctcgtgaacaacaaacttatacccgtacagcagaaaacgag
gtgaaaaatcttttccctcgtttaccaaaccctgatttagtgatgtatgtttatccgcac
ttaactgattcctcagagcaaatgcctgtaccaggttattcttcagtaattccattttat
ggacgtgtgcaatatgcccaaccgggtgagcgtacaagaatgtactag

DBGET integrated database retrieval system