KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0134
Entry
NTHI0134          CDS       T00248                                 
Name
(GenBank) conserved hypothetical protein
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG FtsK_SpoIIIE AAA_29 AAA_10 AKAP7_NLS ResIII T2SSE DUF87 AAA_22
Other DBs
NCBI-ProteinID: AAX87120
UniProt: Q4QPC7
Position
119292..122162
AA seq 956 aa
MALFQDVLEAFFPAKKGDKPQPKKEPILTSIAPEEAQQDDTNNVEETIEITPVMRNRKMT
REQHVKMLYGRDPSFISNLPYAEYLEEEGVMLFDDAKSAGAVFDIKPIGTEGRSSDYLNR
VRTLVKDALQDSFDELDTNPYVVQFYCQDDKDLSGYVENLRQYIKTTSPEASGSEFTEQW
LGEMERHLKAVGKPGGLFVDDRVTNTAWAGKVRKTRMVIYRYAGNNETDTIEKLNTACDR
VQSAFITAGLTMERQNETQIHRWLLEWFNPNPSRYFNGLDDKACYDLLSLSKDESALPLQ
DQDFSENLFFTPPESKNGYWYFNEQPHEVIVVDNIRKQPDVGHMTGEVTRGRNINALFDL
LPESTIMAITVVIHPQDKLQAHLDKLSSRAVGNNYESIYLKQDALTVTEYLKDGHKLYQA
GMVFYVRGKDDQELRIRSRELRTVLLSNNLVPVKEGNEVAPLNSYLRWLPMNFNPQLDAK
SRFYTKYYWVQHIANMLPVFGRETGTGHPGITYFNRGGSPLDFDPLNPKDRTKNAHKLIL
GPTGSGKSATLTAQMAQLMAVHRPRLFIVEAGNSFGLFSDYAERYGLTVNRVSLEPSSNI
ALPLFSEAHRLLEMDIDLEVQDDDDNEDEGEEQRDLLAEMELTARLMITGGEAKEDEKMS
RADRSAIRQAILLAAEKTSQETPPRQVLTGDVKAALEELSRRQDIRPERASRLADMAEAM
DIFCTGVNGRFFNREGEIWPEADITLVDLAMFARDGYEAELAISYISLINHINSLGEKYQ
HSFRPIVNITDESHIITVNPLLAKFLVKGSKMWRKLGIWLWLATQNMADFPDESDKLLSM
VEWWELLNLSNDEVEQVNRFRRLSEAQKMMLLSAKKADKKYTEGVVLATNMEALFRVVPP
SLYLALGMTEKHEKAQRKQLMMEHNCTELDAALMVAKDLDKKRGIAVNDELNSIAA
NT seq 2871 nt   +upstreamnt  +downstreamnt
atggcattattccaagacgtgttagaggctttcttccctgctaaaaaaggtgataagcct
caacctaaaaaggaacctatcctaacatccattgcaccggaagaagcacagcaggatgat
accaataacgtagaagagacgattgaaatcactcctgttatgcgtaatagaaaaatgacc
agagagcaacatgttaaaatgctttatgggcgcgatccctcttttatctccaatcttcct
tatgcggaatatttggaagaagaaggcgtaatgctttttgatgatgctaaaagtgcaggt
gcggtatttgatattaagcctataggaactgagggaagaagcagcgactatcttaatcgc
gttcgcacattggttaaagatgccttacaggatagtttcgatgaacttgataccaaccct
tacgttgtacaattctattgccaggatgacaaggatttaagcggttatgttgagaatctg
agacagtacattaaaaccacttcacctgaagcgagcggtagtgagtttacagaacagtgg
cttggtgaaatggagcgtcacttaaaagcagtaggtaaaccaggtgggctttttgttgat
gaccgggtaacaaatacggcatgggctggaaaagtgcgtaaaacacgcatggttatttat
cgttatgctggaaataatgagacagatacaatcgagaaattaaatacagcttgtgatcgt
gttcaaagtgcttttatcacagctggattaaccatggaacgccaaaatgaaacacaaatt
catcgttggttattagaatggtttaatccaaatccatcacgctattttaacggactcgat
gataaagcttgctatgatcttttatcactctctaaggatgaatctgctctaccattacaa
gaccaagattttagtgaaaatctcttttttacgccaccggaaagtaaaaatggctattgg
tattttaatgagcaacctcacgaagtcattgtagttgataatattcgtaagcagccggat
gttggccacatgacaggcgaagtcactcgaggtcgtaatattaatgcactatttgattta
ttgccggaatcaaccattatggctatcactgtagtcattcatcctcaagataaattacag
gcgcatttagacaaattaagtagtcgagctgtcggtaataactatgagtctatctattta
aaacaagatgccctcacagtaacggaatatttaaaagacggacacaagctttatcaagct
ggcatggttttctatgtaagagggaaagacgatcaagagctacgcattcgctcaagagaa
ttaagaacggttttactcagtaataatttagtgccggtaaaagaaggcaacgaagttgcg
cctcttaatagctatttacgctggctaccgatgaattttaatcctcaattagatgcaaaa
tctcgtttttataccaaatattattgggtgcaacacattgcgaatatgttacctgtattt
ggccgtgagaccggaacgggacacccaggaatcacctattttaaccgcggtggaagccca
ttagattttgacccactaaaccctaaagaccggactaaaaatgcgcataagctcatttta
ggccctacaggttcaggtaaatcggcaacattaaccgcacaaatggcacaactgatggcg
gtgcaccgtcctcgcttgtttattgtagaagcaggtaactcttttggattgttttcagat
tatgcggagcgttacggtttaacggttaaccgggtatctcttgagccaagtagtaacatc
gctttaccgctcttctctgaagcgcatcgtttattggaaatggatatcgatcttgaagtt
caagatgatgacgataatgaagatgaaggcgaggaacaacgagacttacttgcggaaatg
gaattaaccgctcgcttaatgatcaccgggggagaagcgaaggaagatgagaaaatgagc
cgtgctgaccgctcggctattcgccaggctattttattagctgcagagaaaacttcacaa
gagaccccacctcgtcaagttttaaccggggatgtaaaagccgcacttgaggagttaagt
cgtcgccaagatattcgcccggaacgtgcatctcgtcttgcagatatggccgaagcaatg
gatattttctgcactggggtaaatggtcgattctttaaccgtgaaggggaaatttggcct
gaagctgatattacacttgtcgatttggcgatgtttgcacgtgatggctatgaagctgaa
ttagcgatttcgtatatttccctaattaaccatatcaactcattaggtgaaaaatatcaa
cacagtttccgccctatcgtgaacattacggatgagtcgcatatcattaccgtaaatcca
cttctagctaagttcctggttaaaggttctaaaatgtggcgtaaattgggtatttggtta
tggttagctacacagaatatggctgacttccctgatgaatctgataaattactcagcatg
gttgaatggtgggaattacttaacctttctaatgatgaagtcgaacaggtaaaccgtttc
cgtcgtttatccgaagctcagaaaatgatgttgttatctgcgaaaaaagcagataagaaa
tatactgaaggtgtggtgctcgcaaccaatatggaagccttattccgtgttgttccacct
agtctttacttagcactagggatgactgaaaaacacgagaaagcacaacgtaaacaatta
atgatggaacataactgtactgagttagatgcggcattgatggttgctaaagacttagac
aaaaaacgggggattgcagtcaatgacgaacttaactcaatcgcagcctaa

DBGET integrated database retrieval system