KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0146
Entry
NTHI0146          CDS       T00248                                 

Definition
(GenBank) conserved putative exported protein
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: AAX87131
UniProt: Q4QPB6
Position
complement(132475..133416)
AA seq 313 aa
MKLKKMTLSGLCIAIALTSISGQASESGQSSLNTASIMASSASTSCLDYKVVGTCFWLFC
TKFGCKIRTSTKIKHYIPEVVVSSYNHQAQNPWVEMNFLSNGVKGGDYQSPHKDYTQATF
KNVDVIGHPQGAISQMLNSTGYYCKSQTTPFVPYYLSGLDFLAWRFGVPEMVYPEALIPG
MREIRANGDTWGNIYPRAGTVTQVHDYKASAVTAHRVADVVTNTFQPHVYIPIAKKDNQS
NGEWFPPPVKEGDEKTHKWQQLHPVTSQSCAIFPDNPPSMLSENGSYAWALWRPYKCCKK
RGQTFLYSIDWSN
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaaattgaaaaaaatgacattatccgggctttgtattgcaattgcgttgaccagtatt
tcaggacaagcttcggagtccggtcaatcttctttaaacactgcatcgattatggcatca
agcgcttcgacaagttgtttagattataaggtcgttggtacttgtttttggctattttgt
acaaaattcggctgtaaaatccggacatctacgaaaataaaacactatattcccgaggta
gtggtttcaagttataaccatcaggctcaaaatccttgggtggaaatgaatttccttagc
aatggggtaaaaggtggagattatcaatcaccacacaaagactatacgcaagcaacattt
aaaaatgttgatgtaatcggtcatccgcagggagcgattagtcaaatgcttaatagtaca
gggtattactgcaaaagtcagacaacgccttttgtgccttattacttgagtggtttggac
tttttagcgtggcgatttggtgttccggaaatggtttatcctgaagcgcttattccaggt
atgagagaaattagagcaaatggagacacttggggaaatatttatccacgagcgggtaca
gtaacacaagttcatgactataaagcttcagctgtaacagcgcatcgagtagcggatgtt
gtgacaaatactttccaaccacatgtatatataccgattgcgaaaaaagataatcaatcg
aatggtgagtggtttccccctccagtgaaagaaggggatgaaaagacacataaatggcaa
cagcttcacccggttacttcacagtcttgtgctattttccctgataacccgccaagtatg
ctatctgaaaatggtagttatgcctgggcattatggcgcccttacaagtgctgtaaaaaa
cgcggacaaacatttttgtatagtattgattggtctaattaa

DBGET integrated database retrieval system