KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0932Help
Entry
NTHI0932          CDS       T00248                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
hit00071  Fatty acid degradation
hit00280  Valine, leucine and isoleucine degradation
hit00310  Lysine degradation
hit00380  Tryptophan metabolism
hit00620  Pyruvate metabolism
hit00630  Glyoxylate and dicarboxylate metabolism
hit00640  Propanoate metabolism
hit00650  Butanoate metabolism
hit00900  Terpenoid backbone biosynthesis
hit01100  Metabolic pathways
hit01110  Biosynthesis of secondary metabolites
hit01120  Microbial metabolism in diverse environments
hit01130  Biosynthesis of antibiotics
hit01200  Carbon metabolism
hit01212  Fatty acid metabolism
hit02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NTHI0932 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    NTHI0932 (atoB)
   00640 Propanoate metabolism
    NTHI0932 (atoB)
   00650 Butanoate metabolism
    NTHI0932 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NTHI0932 (atoB)
   00072 Synthesis and degradation of ketone bodies
    NTHI0932 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NTHI0932 (atoB)
   00310 Lysine degradation
    NTHI0932 (atoB)
   00380 Tryptophan metabolism
    NTHI0932 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NTHI0932 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NTHI0932 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NTHI0932 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hit04147]
    NTHI0932 (atoB)
Enzymes [BR:hit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NTHI0932 (atoB)
Exosome [BR:hit04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NTHI0932 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AAX87819
UniProt: Q4QMC8
Position
complement(898879..900060)
Genome map
AA seq 393 aa AA seqDB search
MENVVIVSAVRTPIGSFNGALSSVSAVDLGAIVIQEAIKRANIESALVNEVIMGNVLQAG
LGQNPARQAALKAGIEKEIPSLTINKVCGSGLKSVALGAQSIISGDADIVVVGGMENMSQ
APYLLDSKVRQGVKMGNLTLRDTMIEDGLTCASNHYHMGITAENIAEQYGISRQAQDELA
LRSQTLASQAVQLGVFDKEIIPVMVKTRKGDIIVSRDEYPKADTTAEGLAKLKPAFKKEG
TVTAGNASGINDGAAALILVSESKAHALGLKAIAKIRSYASGGVDPSVMGLGPVPATQKA
LKKAGINLDDIDLIEANEAFASQFLGVGKDLNLDMNKTNIHGGAIALGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGQGISMIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgttgttattgttagtgcagttagaacaccgatcggcagctttaatggtgca
ttatcttccgtaagtgcggttgatttaggcgcaattgtgatacaagaagccatcaaacgt
gccaacattgaaagtgcattagttaatgaagtcatcatggggaacgtattacaagcagga
ctagggcaaaatccagcccgtcaagcagcattaaaagcaggaatagagaaagaaatccct
tctttaacaatcaataaagtatgtggatctggtctaaaaagtgtcgcattaggtgcacag
tctattatcagtggtgatgctgatattgttgttgtgggtggcatggaaaatatgagccaa
gcaccttatcttttagatagcaaagtacgacaaggcgtcaaaatgggtaatctcacatta
agggacacaatgattgaagacggactaacttgtgctagcaatcactatcatatggggatt
actgccgaaaatattgcagaacaatatggtattagccgccaagcacaagatgaactcgca
ttacgttcacaaaccttagcatctcaagccgtgcaattaggtgtatttgataaggaaatt
atccctgttatggtaaaaactcgcaaaggtgacattattgtttcacgagacgagtatcct
aaagcagatactacagctgaaggtttagctaaattaaaacctgctttcaaaaaagagggt
actgtcaccgcaggtaacgcttctggcattaatgatggtgctgcagcacttattttagtt
agcgaaagcaaagctcatgcacttggattaaaagccattgcaaaaattagaagctatgcc
agcggtggggtagatccatctgttatgggattaggtccagttccagcaacgcaaaaagca
ttgaaaaaagcaggaataaatcttgatgatatcgatctgatagaagcaaatgaagccttt
gcctcacagttcttaggtgttggcaaagatctcaatttggatatgaataaaaccaatatt
catggtggagctatcgcacttgggcatccaatcggtgcgagtggtgcaaggattttagta
acgttattgcacaatcttatcgaaaaagataaaaaacttggacttgctacactttgtatt
ggcggtggtcaaggtatttctatgattgtagaacgcttataa

DBGET integrated database retrieval system