KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1434Help
Entry
NTHI1434          CDS       T00248                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
hit00900  Terpenoid backbone biosynthesis
hit01100  Metabolic pathways
hit01110  Biosynthesis of secondary metabolites
hit01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NTHI1434 (ispE)
Enzymes [BR:hit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NTHI1434 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AAX88254
UniProt: Q4QL43
Position
complement(1359101..1360054)
Genome map
AA seq 317 aa AA seqDB search
MNTLMKSHQFSTALCQNTTQSNGQPLRFPSPAKLNLFLYINGKLPNGYHELQTLFQFLDF
GDWLDISIREQDNQIVLTPEIPNLKTENNLIYRAAKLLQEKANIQLGANIHLDKILPMGG
GVGGGSSNAATALVSLNYLWQANLSIDELAKLGLTLGADVPIFVYGQAAFAEGVGEKITY
CEPAEKWFVILKPDDSISTAVIFQDPNLPRNTPKKSLEQLLSEPYKNDCEKVVINHYSNV
EKALNWLLQYAPARLTGTGACVFAEFDHEAEAQAVFRQKPEAFFGFVAKGLNVSPLHAML
KQLSSTHTHRQSKPEVL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaatacattaatgaaatcacatcaattttctaccgcactttgccaaaatacaacacaa
tcaaatgggcagccattacgcttccctagccctgccaaactgaatttatttctttatatc
aatggaaaattgccgaacggctatcatgaattacaaacgcttttccaatttttagatttt
ggcgattggttagacattagtattcgggaacaagataatcaaattgttttaacgccagaa
attccaaatctaaaaacggaaaataatctaatttatcgagctgcaaaacttttacaagaa
aaagccaatattcaattgggtgcaaatattcatttagataaaattcttccaatgggaggc
ggtgttggtggcggttcatccaatgcagcaaccgcattagtctctttaaattatttatgg
caagccaatttatccattgatgaactggcaaaattgggattaacattaggcgcggatgtg
ccaatatttgtatacggacaggctgcttttgctgaaggcgttggggaaaaaatcacttat
tgtgaacctgccgagaaatggtttgttatattaaaacccgatgattcaatatcgacggct
gtcatctttcaagatccaaatttaccacgtaatacaccgaaaaaatccctcgaacaactt
ttgagtgaaccttataaaaacgattgcgaaaaagttgtgataaatcattattcaaacgtt
gaaaaagcgttaaactggttgctacaatatgcgccggcaagattaacaggaacgggagcc
tgtgtttttgctgaatttgatcatgaagcagaagcgcaagcggtatttagacaaaaacca
gaagcattttttggtttcgtcgctaaaggactcaatgtgtctcccttgcacgcaatgttg
aagcagctatcatcaactcatactcatcgacaatctaaacctgaggttttataa

DBGET integrated database retrieval system