KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1691Help
Entry
NTHI1691          CDS       T00248                                 

Gene name
dxs
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
hit00730  Thiamine metabolism
hit00900  Terpenoid backbone biosynthesis
hit01100  Metabolic pathways
hit01110  Biosynthesis of secondary metabolites
hit01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hit00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    NTHI1691 (dxs)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NTHI1691 (dxs)
Enzymes [BR:hit01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     NTHI1691 (dxs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C TPP_enzyme_C E1_dh Transketolase_N
Motif
Other DBs
NCBI-ProteinID: AAX88481
UniProt: Q4QKG6
Position
complement(1560093..1561970)
Genome map
AA seq 625 aa AA seqDB search
MTNNMNNYPLLSLINSPEDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASGLGTVELT
VALHYVYKTPFDQLIWDVGHQAYPHKILTGRREQMSTIRQKDGIHPFPWREESEFDVLSV
GHSSTSISAGLGIAVAAERENAGRKTVCVIGDGAITAGMAFEALNHAGALHTDMLVILND
NEMSISENVGALNNHLARIFSGSLYSTLRDGSKKILDKVPPIKNFMKKTEEHMKGVMFSP
ESTLFEELGFNYIGPVDGHNIDELVAMLTNMRNLKGPQFLHIKTKKGKGYAPAEKDPIGF
HGVPKFDPISGELPKNNSKPTYSKIFGDWLCEMAEKDAKIIGITPAMREGSGMVEFSQRF
PKQYFDVAIAEQHTVTFATGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAID
RAGIVGADGATHQGAFDISFMRCIPNMIIMTPSDENECRQMLYTGYQCGKPAAVRYPRGN
AVGVKLTPLEMLPIGKSRLIRKGQKIAILNFGTLLPSALELSEKLNATVVDMRFVKPIDI
EMINVLAQTHDYLVTLEENAIQGGAGSAVAEVLNSSGKSTALLQLGLPDYFIPQATRQEA
LADLGLDTKGIEEKILNFIAKQGNL
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgactaataatatgaacaattatcctcttttatctttaattaattctccagaagatttg
cgtcttttaaataaagatcagctaccacaactctgtcaagaattacgtgcttatctttta
gaatctgttagtcaaactagcggacatttagcgtcaggtttaggcactgttgagctaacc
gttgcgctgcattatgtatataagacgccatttgatcagttaatttgggatgtgggacat
caagcttatccacataaaatcctaacgggtcgccgagagcaaatgtccacaattcgccaa
aaagacggtattcatccttttccttggcgtgaagaaagtgaatttgatgtattaagtgtt
ggtcactcctctacgtctattagtgcgggattaggcattgccgttgccgcagaacgagaa
aatgcaggtagaaaaacagtatgcgtcatcggtgatggcgcaattactgcgggaatggca
tttgaggcattaaatcacgcgggggcattgcatacagatatgttagttattttaaatgat
aacgaaatgtctatttcagaaaacgttggtgcattaaataatcatcttgcgcgtattttc
tctggctctctttactctacgcttcgtgatggcagtaaaaaaatccttgataaagttccg
ccaatcaaaaactttatgaaaaaaaccgaagaacatatgaaaggtgtaatgttttcgcca
gaaagtacattatttgaagaactcggttttaactatattggcccagtggatgggcataac
attgatgaattagtggcaatgcttacgaatatgcgtaatctgaaaggcccacaatttttg
catataaaaacgaaaaaaggtaaaggatacgcacccgcagaaaaagatccgattggtttc
cacggtgtacctaaatttgatccaatcagtggcgaattgcccaaaaacaatagtaaacca
acttattcgaaaatttttggcgattggctatgtgaaatggcagaaaaagatgccaaaatt
ataggtatcacacctgcaatgcgtgagggttcaggtatggtagaattttcccaacgcttc
ccaaaacaatattttgacgtagcgattgcagaacagcacaccgtcacgtttgccacagga
cttgcaattggcggatataaacctgtcgtcgcaatttactcgacatttttacaacgtgct
tacgatcaattaattcatgatgttgccattcaaaatctccccgtgctatttgcgattgat
cgagcagggatagttggcgcagatggggctacacatcaaggtgcattcgatattagcttt
atgcgttgcattccaaatatgatcattatgacgccgagtgatgaaaatgaatgccgtcaa
atgctctatacaggttatcaatgtggaaaacctgcggcagtgcgttaccctcgcggaaat
gccgttggtgtaaaacttactcctttagaaatgcttcctattggtaaatcacgtttaatt
cgaaaaggtcaaaaaattgcgattttaaattttggtactctattaccatccgctttagag
ttatcagaaaaactcaatgcaacggttgtcgatatgcgttttgtgaaaccgattgatatt
gaaatgattaatgtgcttgcacaaactcacgattatttggtcacattggaagaaaatgca
attcaaggtggagcgggatctgctgttgcggaagtactaaattcatcaggaaaatcaacc
gcacttttacaacttggtttgccagattattttattccacaagcgacacggcaagaagca
ttggcagatttaggattggatacaaaaggcattgaagaaaaaattctcaactttattgca
aaacaaggtaatttataa

DBGET integrated database retrieval system