KEGG   Haemophilus influenzae 10810 (serotype b): HIB_09020Help
Entry
HIB_09020         CDS       T01720                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
hiu00071  Fatty acid degradation
hiu00280  Valine, leucine and isoleucine degradation
hiu00310  Lysine degradation
hiu00380  Tryptophan metabolism
hiu00620  Pyruvate metabolism
hiu00630  Glyoxylate and dicarboxylate metabolism
hiu00640  Propanoate metabolism
hiu00650  Butanoate metabolism
hiu00900  Terpenoid backbone biosynthesis
hiu01100  Metabolic pathways
hiu01110  Biosynthesis of secondary metabolites
hiu01120  Microbial metabolism in diverse environments
hiu01130  Biosynthesis of antibiotics
hiu01200  Carbon metabolism
hiu01212  Fatty acid metabolism
hiu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HIB_09020
   00630 Glyoxylate and dicarboxylate metabolism
    HIB_09020
   00640 Propanoate metabolism
    HIB_09020
   00650 Butanoate metabolism
    HIB_09020
  Lipid metabolism
   00071 Fatty acid degradation
    HIB_09020
   00072 Synthesis and degradation of ketone bodies
    HIB_09020
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HIB_09020
   00310 Lysine degradation
    HIB_09020
   00380 Tryptophan metabolism
    HIB_09020
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HIB_09020
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HIB_09020
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HIB_09020
Enzymes [BR:hiu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HIB_09020
Exosome [BR:hiu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HIB_09020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CBW29089
UniProt: E1XB73
Position
complement(938129..939310)
Genome map
AA seq 393 aa AA seqDB search
MENVVIVSAVRTPIGSFNGALSSVSAVDLGAIVIQEAIKRANIESALVNEVIMGNVLQAG
LGQNPARQAALKAGIEKEIPSLTINKVCGSGLKSVALGAQSIISGDADIVVVGGMENMSQ
APYLLDSKVRQGVKMGNLTLRDTMIEDGLTCASNHYHMGITAENIAEQYGISRQAQDELA
LRSQTLASQAVQLGVFDKEIVPVMVKTRKGDIIVSRDEYPKADTTAEGLAKLKPAFKKEG
TVTAGNASGINDGAAALILVSESKAHALGLKAIAKIRSYASGGVDPSVMGLGPVPATQKA
LKKAGINLDDIDLIEANEAFASQFLGVGKDLNLDMNKTNIHGGAIALGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGQGISMIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgttgttattgttagtgcagttagaacaccgatcggcagctttaatggtgca
ttatcttccgtaagtgcggttgatttaggtgcaattgtgatacaagaagccatcaaacgt
gccaacattgaaagtgcattagttaatgaagtcatcatggggaacgtattacaagcagga
ctaggacaaaatccagcccgtcaagcagcattaaaagcaggaatagagaaagaaatccct
tctttaacaatcaataaagtatgtggatctggtctaaaaagtgtcgcattaggtgcacag
tctattatcagtggtgatgctgatattgttgttgtgggtggcatggaaaatatgagccaa
gcaccttatcttttagatagcaaagtacgacaaggcgtcaaaatgggtaatctcacatta
agggacacaatgattgaagacggactaacttgtgctagcaatcactatcatatggggatt
actgccgaaaatattgcagaacaatatggtattagccgccaagcacaagatgaactcgca
ttacgttcacaaaccttagcatctcaagccgtgcaattaggtgtatttgataaggaaatt
gtccctgttatggtaaaaactcgcaaaggtgacattattgtttcacgagacgagtatcct
aaagcagatactacagctgaaggtttagctaaattaaaacctgctttcaaaaaagagggt
actgtcaccgcaggtaacgcttctggcattaatgatggtgctgcagcacttattttagtt
agcgaaagcaaagctcatgcacttggattaaaagccattgcaaaaattagaagctatgcc
agcggtggggtagatccatctgttatgggattaggtccagttccagcaacgcaaaaagca
ttgaaaaaagcaggaataaatcttgatgatatcgatctgatagaagcaaatgaagccttt
gcctcacagttcttaggtgttggcaaagatctcaatttggatatgaataaaaccaatatt
catggtggagctatcgcacttgggcatccaatcggcgcgagtggtgcaaggattttagta
acgttattgcacaatcttatcgaaaaagataaaaaacttggacttgctacactttgtatt
ggcggtggtcaaggtatttctatgattgtagaacgcttataa

DBGET integrated database retrieval system