KEGG   Haemophilus influenzae 10810 (serotype b): HIB_12730Help
Entry
HIB_12730         CDS       T01720                                 

Definition
(GenBank) ADP-L-glycero-D-mannoheptose-6-epimerase, NAD(P)-binding
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
hiu00540  Lipopolysaccharide biosynthesis
hiu01100  Metabolic pathways
Module
hiu_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hiu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HIB_12730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hiu01005]
    HIB_12730
Enzymes [BR:hiu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     HIB_12730
Lipopolysaccharide biosynthesis proteins [BR:hiu01005]
 Unusual sugar
  HIB_12730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR adh_short
Motif
Other DBs
NCBI-ProteinID: CBW29460
Position
complement(1310261..1311187)
Genome map
AA seq 308 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNDLGRKDILVVDNLKDGTKFANLVDLDIADYCDKEDFIASI
ISDDEFGDIDAVFHEGACSATTEWDGKYIMHNNYEYSKELLHYCLDREIPFFYASSAATY
GDTKVFREEREFEGPLNVYGYSKFLFDQYVRNILPEAKSPVCGFRYFNVYGPRENHKGSM
ASVAFHLNNQILKGENPKLFAGSEHFRRDFVYVGDVAAVNIWCWQNGISGIYNLGTGNAE
SFRAVADAVVKFHGKGEIETIPFPEHLKSRYQEYTQADLTKLRSTGYDKPFKTVAEGVAE
YMAWLNRK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgtaacaggcggtgctggttttattggcagcaatattgtcaaagcattgaat
gatttaggacgcaaagatattttagtggtcgataacttaaaagatggcacgaaatttgca
aatttagttgatttagacattgcagattattgtgataaagaagatttcattgcttctatt
atttcggacgatgaatttggcgatattgatgcggtattccacgagggggcttgttctgcg
actacggaatgggatggcaaatacattatgcacaacaactacgaatattctaaagagtta
ttgcactattgccttgatcgcgaaattccttttttctatgcctcaagtgcggcaacttat
ggagacaccaaagtattccgtgaagaacgtgaatttgaaggcccattaaatgtgtatggc
tattctaaattcttgttcgatcaatatgtgcgtaacattttgccagaagcaaaatcgcca
gtatgtggtttccgttatttcaatgtttacgggccgcgtgaaaatcataaaggttctatg
gcgagtgtagcattccacttgaataaccaaatcttaaaaggcgaaaatccaaaattattt
gcaggcagcgaacacttccgtcgtgattttgtttatgtgggtgatgtggctgcagtgaat
atttggtgttggcaaaatggtatttcgggtatttacaaccttggtacaggaaatgcagaa
agtttccgtgcggtggctgatgcggtagtgaaattccacggaaaaggcgagattgaaacc
attccattcccagagcatttgaaatctcgttatcaagaatatactcaagcagatttaact
aaacttcgctcaacaggctacgataaaccattcaaaacagtcgcggaaggcgtggctgaa
tatatggcgtggttgaatagaaaataa

DBGET integrated database retrieval system