KEGG   Haemophilus influenzae 10810 (serotype b): HIB_16350Help
Entry
HIB_16350         CDS       T01720                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
hiu00260  Glycine, serine and threonine metabolism
hiu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hiu01100  Metabolic pathways
hiu01110  Biosynthesis of secondary metabolites
hiu01130  Biosynthesis of antibiotics
hiu01230  Biosynthesis of amino acids
Module
hiu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIB_16350
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HIB_16350
Enzymes [BR:hiu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HIB_16350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBW29821
UniProt: E1X7U8
Position
1685863..1687056
Genome map
AA seq 397 aa AA seqDB search
MSDALLNPYFGEFGGMYVPEILVPVLKQLEQAFVEAQNDPTFQAEFADLLKNYAGRPTAL
TLCRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSCSLKDACCEAMRDWSA
NYETTHYLLGTAAGPHPFPTIVKEFQKMIGEETKRQILEREGRLPDAVIAAVGGGSNAIG
MFADFIDESNVRLIGVEPAGKGIETGEHGAPLKHGTTGIYFGMKSPIMQDKDGQIEESYS
ISAGLDFPSVGPQHAYLNEIGRADYVSITDEEALNAFQELAKHEGIIPALESSHALAYAL
KLIKQNPEKEQLLVVNLSGRGDKDIFTVDKILNGGTN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgcacttcttaacccttattttggcgaatttggcggaatgtatgtacccgaa
attttagtgcctgttttaaagcaattagaacaagcctttgtggaggctcaaaatgatcct
acattccaagcagaatttgctgatttactcaaaaattatgcgggcagaccgaccgcactt
actctttgtcgtaacttaactaaaggtacaaaaactaaactttatcttaaacgtgaagat
ttattacacggtggtgcacacaaaaccaaccaggtgttagggcaaattttattggctaaa
cgtatgggcaaaacgcgtattattgccgaaacaggtgcgggtcagcacggtgttgcgacc
gccctagcttgtgctatgttagatatgccgtgtcgtgtttatatgggtgcaaaagatgtt
gagcgtcaatcaccaaacgtgttccgtatgcgtttaatgggcgcggaagtgattcctgta
caaaaaggctcttgttctttaaaagatgcctgttgtgaagcgatgcgtgattggtcagca
aactatgaaactacccattatttacttggaacggcggcaggccctcaccccttcccgacg
attgtgaaagaatttcaaaaaatgattggcgaagaaaccaaacgtcaaattctcgaacgg
gaaggtcgtttacctgatgcagtcattgctgctgttggcggtggctcgaatgcaattggt
atgtttgctgattttattgatgaatccaatgtgcgtttaattggtgttgagcctgcgggt
aaaggtattgaaacgggcgaacacggtgcaccgctcaagcacggcacaacaggcatctac
ttcggaatgaaatcgccaattatgcaagataaagatggacaaattgaggaatcctattcc
atttctgcagggttagattttccctctgtcgggccgcaacatgcttatttaaatgagatt
ggtcgtgctgattatgtatcgattaccgatgaagaagcccttaacgcattccaagaattg
gcaaaacacgaaggtattattcctgcattagaaagctcacacgccttggcttatgccttg
aaattgattaaacaaaatcctgaaaaagaacaacttttagtggttaatctttcaggacga
ggcgataaagatatttttaccgttgataaaattttaaatggaggaacgaactaa

DBGET integrated database retrieval system