KEGG   Haemophilus influenzae 10810 (serotype b): HIB_16550Help
Entry
HIB_16550         CDS       T01720                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
hiu00790  Folate biosynthesis
hiu01100  Metabolic pathways
Module
hiu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HIB_16550
Enzymes [BR:hiu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HIB_16550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: CBW29841
UniProt: E1X7W8
Position
complement(1700942..1701598)
Genome map
AA seq 218 aa AA seqDB search
MSKISLDALNVRNALIEKGIETPMIDPTQAKNERRESIAKHMNEVMKLIGLDLRDDSLEE
TPNRLAKMFIDEIFSGMDYANFPKMTKIKNQMKVSEMVQVNDITLTSTCEHHFVTIDGKV
CVAYYPKDWVIGLSKINRIVSFFAQRPQVQERLTEQLLTAFQTILETDDVAVYVRATHFC
VKARGIRDTNSYTVTSAYGGVFLEDRDTRKEFLATVQK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatttcactggatgcactgaatgtaagaaatgccttgattgaaaaaggtatt
gagacacccatgattgatccaacacaggctaaaaatgaacgccgagaaagcattgcaaaa
catatgaatgaagtgatgaaactgattggattagatttgcgagatgatagtttagaagaa
acgccaaatcgtttagctaaaatgtttattgatgagatttttagtggaatggattatgcg
aattttccaaagatgacaaaaatcaaaaatcaaatgaaagtcagcgaaatggtgcaagtg
aatgacatcacgctaacaagcacttgtgaacatcattttgtgacgattgatggtaaagtt
tgtgtggcatactatccaaaagattgggtgattggtctttctaaaattaatcgaatcgtt
tcattttttgcgcaacgtccacaggttcaagaacgcttaactgagcaacttttgacagca
tttcaaaccattcttgaaaccgatgatgtggcggtatatgtgagagcgacccatttctgt
gtgaaagcgcgtggtattagagatacaaatagttatactgtcacatctgcttatggtggc
gtattcttagaagatagagatactcgtaaagaatttttagctacagttcaaaaatag

DBGET integrated database retrieval system