KEGG   Haemophilus influenzae 10810 (serotype b): HIB_17110Help
Entry
HIB_17110         CDS       T01720                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
hiu00780  Biotin metabolism
hiu01100  Metabolic pathways
Module
hiu_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:hiu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HIB_17110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hiu01007]
    HIB_17110
Enzymes [BR:hiu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     HIB_17110
Amino acid related enzymes [BR:hiu01007]
 Aminotransferase (transaminase)
  Class II
   HIB_17110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CBW29896
Position
complement(1755496..1756638)
Genome map
AA seq 380 aa AA seqDB search
MDAFKQQLEQLCTQNQYRSIPDLVHQGRYITRENRKMLNMSSNDYLGLASNENLRQSFLQ
QYGGNFPSFTSSSSRLLTGNFPIYTDLEELVAQRFQRESALLFNSGYHANIGILPALTTT
KSLILADKLVHASMIDGIRLSQCEFFRYRHNDYEHLKSLLEKNAGKFDRTFIVTESVFSM
DGDMADLKQLVQLKKQFPNTYLYVDEAHAIGVYGQNGLGIAERDNLIAEIDLLVGTFGKA
LASMGAYVVCDQILKECLINQMRPLIFSTALPPFNVAWTHFIFERLPQFSKERTHLEQLS
AFLRQEVEHRTQIMPSQTCIVPYILGENEATLAKAKDLQEQGYYCLPIRPPTVPKGTSRI
RLSLTVDMTMDEVKQFVACL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggatgctttcaaacagcaactggaacagctttgtacacaaaatcaatatcgttcaatt
ccagatttagttcatcaaggacgatatattacgcgagaaaatcgcaaaatgctgaatatg
tcatctaatgattatttaggtttggcatcaaatgaaaacttgcgccagtcttttttacag
caatacggcggtaatttcccctcttttaccagttcttcatcgcgtttattaacgggcaac
tttcctatttataccgatttggaagagcttgtcgcacaacgtttccaacgggaaagtgcg
ttattatttaacagcggctatcacgccaatatcggcattttgcctgctttgacgacgacg
aaaagtttaattttggcagataaattagtgcatgccagcatgattgatggcattcgttta
agccaatgtgagttctttcgttatcgtcataatgattatgaacatctaaagagtctgctc
gaaaaaaatgctggaaaatttgaccgcacttttatcgttaccgaatctgttttcagtatg
gacggcgacatggcggatttgaaacagcttgttcaattaaaaaaacaatttcccaatact
tatctttatgtggatgaagcccacgccatcggtgtttatgggcaaaacggattgggtatt
gccgaacgggataatctgattgccgaaattgatttattggttggcacttttggcaaggcc
ttagcttcaatgggggcttatgtcgtctgtgatcaaatattaaaagaatgtttgattaat
caaatgcgtccattgattttttcaaccgcacttccgccctttaatgtggcttggactcat
tttatttttgaacgattgccacaattttcaaaagaaagaactcatcttgagcagttaagt
gcatttttacgccaagaagtggaacacagaacgcaaataatgccaagccaaacttgcatc
gttccctatattttaggcgagaacgaagcaacccttgctaaggcgaaagatctgcaagag
caaggttattattgcttgccgattagaccaccgacagtaccaaaaggtacatccagaata
cgattgtctttgacggtagatatgacaatggatgaagtgaaacagtttgtggcatgctta
taa

DBGET integrated database retrieval system