KEGG   Haemophilus influenzae 10810 (serotype b): HIB_17840Help
Entry
HIB_17840         CDS       T01720                                 

Definition
(GenBank) putative phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Brite
KEGG Orthology (KO) [BR:hiu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HIB_17840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CBW29969
Position
1820385..1821647
Genome map
AA seq 420 aa AA seqDB search
MEIISQYGSWLVWITAAFGFFMAFGIGANDVSNSMGTSVGSGTITAKQAIIIALIFESAG
AYLAGGEVTQTIKSGVIDPIQFVDTPDILALGMLSTLFASGAWLFIATKMGWPVSGTHTI
IGAIIGFACITIGPSSVDWSKIGSIVGSWFVTPVIAGILAYAIFASTQKLIFDTEQPLKN
AQKYGPYYMGITVFVLCIVTMKKGLKHVGLNLSNSETLIISLAISLIGMFFFHFYFKSKI
FTQSANKGTFGAVEKVFSILMLLTACAMAFAHGSNDVANAIGPLSAVVSIVNEGGKIVSG
GALTWWILPLGALGIAVGLITMGQKVMATVGSGITDLTPSRGFAAQFATAMTVVVASGTG
LPISTTQTLVGAILGIGFARGIAALNLTVIRNIISSWIVTLPAGAFFAIIIFYVLRTIFN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaaattattagtcaatatggttcttggttggtgtggatcacagcagcctttggcttt
tttatggcgttcggaattggagcgaatgatgtctcaaactcaatgggaacatcagtagga
tctggtaccataaccgccaaacaagcaattattatcgcattaatttttgaatctgctggt
gcctatctagcaggtggtgaagtaacacaaaccattaaaagtggtgtaatcgatccaata
caatttgtcgatacgccagatattttagctctaggtatgctttcaaccttatttgcatct
ggggcttggttatttattgcaaccaaaatgggttggccagtttctggtacacacactatt
attggtgcaattattggatttgcctgtattacgattggccctagttctgtagattggtca
aagattggcagcatcgttggtagctggtttgtcacgcctgtcattgcgggtattttggct
tatgcaatctttgcaagtacacaaaaacttatttttgataccgaacaaccactaaaaaat
gcacaaaaatatggcccttattatatggggataaccgtgtttgtactttgtatcgtgacg
atgaaaaaaggcttaaaacacgtaggcttaaatctttcaaacagtgaaactttaatcatt
tcacttgccatcagtcttatcggaatgtttttcttccatttctattttaaaagcaaaatc
ttcactcaatcagcaaacaaaggcacttttggtgcagtagaaaaagtcttcagtatttta
atgttattaaccgcttgtgcgatggcatttgcgcacggttctaatgacgtagccaatgca
attggccctctttctgcagtggtctctattgtaaatgaaggcggtaaaattgtttcaggt
ggagccttaacttggtggattttacccttaggtgcattaggtattgctgtgggcttaatt
actatgggacaaaaagtgatggcgactgttggatctgggatcaccgatttaacgccaagc
cgtggctttgccgctcaatttgctactgcgatgactgttgtcgtggcatcaggcacaggc
ttgccgatctcaacaacacaaactcttgttggggcaattttaggtatcggttttgctcgc
ggtatcgctgcactgaatttaacggttattcgaaacatcattagttcttggattgtcaca
ttaccagcaggcgcatttttcgccattattattttctatgtgctaagaactatctttaat
taa

DBGET integrated database retrieval system