KEGG   Haemophilus influenzae 477: NTHI477_00935Help
Entry
NTHI477_00935     CDS       T03720                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hiw  Haemophilus influenzae 477
Pathway
hiw00071  Fatty acid degradation
hiw00280  Valine, leucine and isoleucine degradation
hiw00310  Lysine degradation
hiw00380  Tryptophan metabolism
hiw00640  Propanoate metabolism
hiw00650  Butanoate metabolism
hiw00900  Terpenoid backbone biosynthesis
hiw01100  Metabolic pathways
hiw01110  Biosynthesis of secondary metabolites
hiw01120  Microbial metabolism in diverse environments
hiw01130  Biosynthesis of antibiotics
hiw01200  Carbon metabolism
hiw01212  Fatty acid metabolism
hiw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hiw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NTHI477_00935 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    NTHI477_00935 (thlA)
   00640 Propanoate metabolism
    NTHI477_00935 (thlA)
   00650 Butanoate metabolism
    NTHI477_00935 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NTHI477_00935 (thlA)
   00072 Synthesis and degradation of ketone bodies
    NTHI477_00935 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NTHI477_00935 (thlA)
   00310 Lysine degradation
    NTHI477_00935 (thlA)
   00380 Tryptophan metabolism
    NTHI477_00935 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NTHI477_00935 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NTHI477_00935 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NTHI477_00935 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hiw04147]
    NTHI477_00935 (thlA)
Enzymes [BR:hiw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NTHI477_00935 (thlA)
Exosome [BR:hiw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NTHI477_00935 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJO87960
UniProt: A0A1Q5Y4Q3
Position
957268..958449
Genome map
AA seq 393 aa AA seqDB search
MENVVIVSAVRTPIGSFNGALSSVSAVDLGAIVIQEAIKRANIESALVNEVIMGNVLQAG
LGQNPARQAALKAGIEKEIPSLTINKVCGSGLKSVALGAQSIISGDADIVVVGGMENMSQ
APYLLDSKVRQGVKMGNLTLRDTMIEDGLTCASNHYHMGITAENIAEQYGISRQAQDELA
LRSQTLASQAVQLGVFDKEIVPVMVKTRKGDIIVSRDEYPKADTTAEGLAKLKPAFKKEG
TVTAGNASGINDGAAALILVSESKAHALGLKAIAKIRSYASGGVDPSVMGLGPVPATQKA
LKKAGINLDDIDLIEANEAFASQFLGVGKDLNLDMNKTNIHGGAIALGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGQGISMIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgttgttattgttagtgcagttagaacaccgatcggcagctttaatggtgca
ttatcttccgtaagtgcggttgatttaggcgcaattgtgatacaagaagccatcaaacgt
gccaacattgaaagtgcattagttaatgaagtcatcatggggaacgtattacaagcagga
ctagggcaaaatccagcccgtcaagcagcattaaaagcaggaatagagaaagaaatccct
tctttaacaatcaataaagtatgtggatctggtctaaaaagtgtcgcattaggtgcacag
tctattatcagtggtgatgctgatattgttgttgtgggtggcatggaaaatatgagccaa
gcaccttatcttttagatagcaaagtacgacaaggcgtcaaaatgggtaatctcacatta
agggacacaatgattgaagacggactaacttgtgctagcaatcactatcatatggggatt
actgccgaaaatattgcagaacaatatggtattagccgccaagcacaagatgaactcgca
ttacgttcacaaaccttagcatctcaagccgtgcaattaggtgtatttgataaggaaatt
gtccctgttatggtaaaaactcgcaaaggtgacattattgtttcacgagacgagtatcct
aaagcagatactacagctgaaggtttagctaaattaaaacctgctttcaaaaaagagggt
actgtcaccgcaggtaacgcttctggcattaatgatggtgctgcagcacttattttagtt
agcgaaagcaaagctcatgcacttggattaaaagccattgcaaaaattagaagctatgcc
agcggtggggtagatccatctgttatgggattaggtccagttccagcaacgcaaaaagca
ttgaaaaaagcaggaataaatcttgatgatatcgatctgatagaagcaaatgaagccttt
gcctcacagttcttaggtgttggcaaagatctcaatttggatatgaataaaaccaatatt
catggtggagctatcgcacttgggcatccaatcggcgcgagtggtgcaaggattttagta
acgttattgcacaatcttatcgaaaaagataaaaaacttggacttgctacactttgtatt
ggcggtggtcaaggtatttctatgattgtagaacgcttataa

DBGET integrated database retrieval system