KEGG   Haemophilus influenzae 723: NTHI723_00799Help
Entry
NTHI723_00799     CDS       T03722                                 

Gene name
pckA
Definition
(GenBank) Phosphoenolpyruvate carboxykinase [ATP]
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
hix  Haemophilus influenzae 723
Pathway
hix00010  Glycolysis / Gluconeogenesis
hix00020  Citrate cycle (TCA cycle)
hix00620  Pyruvate metabolism
hix01100  Metabolic pathways
hix01110  Biosynthesis of secondary metabolites
hix01120  Microbial metabolism in diverse environments
hix01130  Biosynthesis of antibiotics
hix01200  Carbon metabolism
Module
hix_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hix00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NTHI723_00799 (pckA)
   00020 Citrate cycle (TCA cycle)
    NTHI723_00799 (pckA)
   00620 Pyruvate metabolism
    NTHI723_00799 (pckA)
Enzymes [BR:hix01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     NTHI723_00799 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AJO91259
UniProt: A0A0D0H1F2
Position
829482..831098
Genome map
AA seq 538 aa AA seqDB search
MTDLNKVVKELEALGIYDVKEVVYNPSYEQLFEEETKPGLEGFEKGTLTTTGAVAVDTGI
FTGRSPKDKYIVLDEKTKDTVWWTSETAKNDNKPMNQATWQSLKDLVTNQLSRKRLFVVD
GFCGASEHDRIAVRIVTEVAWQAHFVKNMFIRPTEEQLKNFEPDFVVMNGSKVTNPNWKE
QGLNSENFVAFNLTERIQLIGGTWYGGEMKKGMFSMMNYFLPLKGVGAMHCSANVGKDGD
VAIFFGLSGTGKTTLSTDPKRELIGDDEHGWDDVGIFNFEGGCYAKTIHLSEENEPDIYR
AIRRDALLENVVVRSDGSVDFDDGSKTENTRVSYPIYHIDNIVKPVSRAGHATKVIFLTA
DAFGVLPPVSKLTPEQTKYYFLSGFTAKLAGTERGITEPTPTFSACFGAAFLTLHPTQYA
EVLVKRMQAAGAEAYLVNTGWNGTGKRISIKDTRGIIDAILDGSIEKAEMGELPIFNLAI
PKALPGVDSAILDPRDTYADKAQWQSKAEDLAGRFVKNFVKYATNEEGKALIAAGPKA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgacagacttaaataaagtggtaaaagaacttgaagctcttggcatttatgacgtaaaa
gaagttgtttacaatccaagctacgagcaattgttcgaagaagaaactaaaccaggctta
gaaggctttgaaaaaggtactttaactacgactggtgcagtggcagtagatacaggtatc
ttcacaggtcgttctccaaaagataaatatatcgtgttagatgaaaaaacaaaagatact
gtttggtggacatctgaaacagcaaaaaacgacaacaagccaatgaaccaagctacatgg
caaagcttaaaagacttggtaactaaccaactttctcgtaaacgcttatttgtagttgat
ggtttctgtggtgcgagcgaacacgaccgtattgcagtacgtattgtcactgaagtagcg
tggcaagcacattttgtaaaaaatatgtttattcgcccaactgaagaacaactcaaaaat
tttgaaccagatttcgttgtaatgaacggttctaaagtaaccaatccaaactggaaagaa
caaggtttaaattcagaaaactttgttgctttcaacttgactgaacgcattcaattaatc
ggcggtacttggtacggcggcgaaatgaaaaaaggtatgttctcaatgatgaactacttc
ctacctctcaaaggtgttggtgcaatgcactgctcagctaacgttggtaaagatggcgat
gtagcaatcttcttcggcttatctggcacaggtaaaacaaccctttcaacggatccaaaa
cgtgaattaatcggagatgatgaacacggttgggatgatgttggtatctttaactttgaa
ggtggttgttatgcgaaaaccattcatctttcagaagaaaatgaaccagatatttaccgc
gctatccgtcgcgacgcattattagaaaacgtggttgttcgttcagatggttctgttgat
ttcgatgatggttcaaaaacagaaaacactcgcgtgtcttacccaatttatcacatcgat
aacattgtaaaaccagtttctcgtgcaggtcacgcaactaaagtgattttcttaactgca
gatgcatttggcgtattaccaccagtatctaaattgacaccagaacaaactaaatactac
ttcttatctggtttcacagcgaaattagcagggactgaacgtggtattactgaaccaacg
ccaactttctcagcatgtttcggtgcagcatttttaacgcttcatccaactcaatatgca
gaagtgttagtaaaacgtatgcaagcagcaggtgctgaagcttacttagtgaatactggt
tggaatggcacaggcaaacgtatctcaatcaaagatactcgcggaatcattgatgcaatc
ttagatggctcaattgaaaaagctgaaatgggcgaattgccaatcttcaacttagcaatt
cctaaagcattaccaggtgtagattctgcaatcttagatcctcgcgatacttacgcagat
aaagcacaatggcaatcaaaagctgaagacttagcaggtcgttttgtgaaaaactttgtt
aaatatgcaactaacgaagaaggcaaagctttaattgcagctggtcctaaagcttaa

DBGET integrated database retrieval system