KEGG   Haemophilus influenzae 723: NTHI723_00839Help
Entry
NTHI723_00839     CDS       T03722                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hix  Haemophilus influenzae 723
Pathway
hix00071  Fatty acid degradation
hix00280  Valine, leucine and isoleucine degradation
hix00310  Lysine degradation
hix00380  Tryptophan metabolism
hix00620  Pyruvate metabolism
hix00630  Glyoxylate and dicarboxylate metabolism
hix00640  Propanoate metabolism
hix00650  Butanoate metabolism
hix00900  Terpenoid backbone biosynthesis
hix01100  Metabolic pathways
hix01110  Biosynthesis of secondary metabolites
hix01120  Microbial metabolism in diverse environments
hix01130  Biosynthesis of antibiotics
hix01200  Carbon metabolism
hix01212  Fatty acid metabolism
hix02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hix00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NTHI723_00839 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    NTHI723_00839 (thlA)
   00640 Propanoate metabolism
    NTHI723_00839 (thlA)
   00650 Butanoate metabolism
    NTHI723_00839 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NTHI723_00839 (thlA)
   00072 Synthesis and degradation of ketone bodies
    NTHI723_00839 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NTHI723_00839 (thlA)
   00310 Lysine degradation
    NTHI723_00839 (thlA)
   00380 Tryptophan metabolism
    NTHI723_00839 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NTHI723_00839 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NTHI723_00839 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NTHI723_00839 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hix04147]
    NTHI723_00839 (thlA)
Enzymes [BR:hix01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NTHI723_00839 (thlA)
Exosome [BR:hix04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NTHI723_00839 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III HTH_7
Motif
Other DBs
NCBI-ProteinID: AJO91297
Position
854461..855642
Genome map
AA seq 393 aa AA seqDB search
MENVVIVSAVRTPIGSFNGALSSVSAVDLGAIVIQEAIKRANIESALVNEVIMGNVLQAG
LGQNPARQAALKAGIEKEIPSLTINKVCGSGLKSVALGAQSIISGDADIVVVGGMENMSQ
APYLLDSKVRQGVKMGNLTLRDTMIEDGLTCASNHYHMGITAENIAEQYGISRQAQDELA
LRSQTLASQAVQLGVFDKEIIPVMVKTRKGDIIVSRDEYPKADTTAEGLAKLKPAFKKEG
TVTAGNASGINDGAAALILVSESKAHALGLKAIAKIRSYASGGVDPSVMGLGPVPATQKA
LKKAGINLDDIDLIEANEAFASQFLGVGKDLNLDMNKTNIHGGAIALGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGQSISMIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgttgttattgttagtgcagttagaacaccgatcggcagctttaatggtgca
ttatcttccgtaagtgcggttgatttaggcgcaattgtgatacaagaagccatcaaacgt
gccaacattgaaagtgcattagttaatgaagtcatcatggggaacgtattacaagcagga
ctagggcaaaatccagcccgtcaagcagcattaaaagcaggaatagagaaagaaatccct
tctttaacaatcaataaagtatgtggatctggtctaaaaagtgtcgcattaggtgcacag
tctattatcagtggtgatgctgatattgttgttgtgggtggcatggaaaatatgagccaa
gcaccttatcttttagatagcaaagtacgacaaggcgtcaaaatgggtaatctcacatta
agggacacaatgattgaagacggactaacttgtgctagcaatcactatcatatggggatt
actgccgaaaatattgcagaacaatatggtattagccgccaagcacaagatgaactcgca
ttacgttcacaaaccttagcatctcaagccgtgcaattaggtgtatttgataaggaaatt
atccctgttatggtaaaaactcgcaaaggtgacattattgtttcacgagacgagtatcct
aaagcagatactacagctgaaggtttagctaaattaaaacctgctttcaaaaaagagggt
actgtcaccgcaggtaacgcttctggcattaatgatggtgctgcagcacttattttagtt
agcgaaagcaaagctcatgcacttggattaaaagccattgcaaaaattagaagctatgcc
agcggtggggtagatccatctgttatgggattaggtccagttccagcaacgcaaaaagca
ttgaaaaaagcaggaataaatcttgatgatatcgatctgatagaagcaaatgaagccttt
gcctcacagttcttaggtgttggcaaagatctcaatttggatatgaataaaaccaatatt
catggtggagctatcgcacttgggcatccaatcggcgcgagtggtgcaaggattttagta
acgttattgcacaatcttatcgaaaaagataaaaaacttggacttgctacactttgtatt
ggcggtggtcaaagtatttctatgattgtagaacgcttataa

DBGET integrated database retrieval system