KEGG   Haemophilus influenzae 723: NTHI723_01563Help
Entry
NTHI723_01563     CDS       T03722                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
hix  Haemophilus influenzae 723
Pathway
hix00520  Amino sugar and nucleotide sugar metabolism
hix01100  Metabolic pathways
hix01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hix00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NTHI723_01563 (nagA)
Enzymes [BR:hix01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     NTHI723_01563 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AJO91970
UniProt: A0A2S9RXR6
Position
1567464..1568609
Genome map
AA seq 381 aa AA seqDB search
MKYALTNSVIYTKYEILRDYAVVIDSETIEAVIPQAELETGIKTIDLQGNNLTAGFIDLQ
LNGCGGVMFNDQTSVETLEIMQETNLKSGCTSFLPTFITAPDENIKSAVKIMREYLNKHK
NQALGLHIEGPYLSIEKKGVHRPEYIREITPEMKDFLCENGDVITKITIAAENPTINYTP
DFVKAGIIVSVGHSNATYEVAKAAFHKGATFATHLHNAMSPISSGREMGVVGAVLDSDVY
TGIIVDGVHINYGNVRIDKKIKGDKLCIVTDSIAAAGAPPELESFTFVGKTIYIKEGRCY
DANGTIAGASITMMESIKNAVEYVEIPLAEAIRMSNLYPARAIGIDDRLGSVEKGKIANL
AVFTPNYQVIGTVVNGKWKEN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgcattaaccaacagtgtgatctacactaaatacgaaattctacgagattat
gcggtagtaattgatagcgaaactattgaagcagtgatcccccaagctgaattagaaaca
ggtatcaaaaccattgatttacaaggtaataatttaacggctggttttattgatctgcaa
ttaaatggctgtggtggcgtgatgtttaacgaccaaaccagcgttgaaaccttggaaatt
atgcaggaaactaacttaaaatcaggttgtacaagtttccttcccacttttattaccgcg
cctgatgaaaatataaaaagtgcggtaaaaattatgcgtgaatatttaaacaagcataaa
aaccaagcacttggtttacatattgaagggccttatctcagcattgagaaaaaaggcgta
caccgccccgaatatattcgtgaaattacgcctgaaatgaaagattttctctgcgaaaat
ggcgatgtgattacaaaaataaccattgccgcagaaaacccaaccattaactatacgcct
gattttgtgaaagcgggcattattgtctctgtaggtcattctaatgccacttatgaagtg
gctaaagccgcattccacaaaggcgcaacatttgcaacccacttacataatgcaatgtcg
ccaattagttctggacgtgaaatgggcgtagtgggcgcagtattagattctgatgtttac
actggcattatcgtggatggtgtgcatatcaattatggcaatgttcgcattgataaaaaa
atcaaaggcgacaaactttgtattgtgactgactctattgcagcggcaggcgcaccgcca
gaactagaaagttttacctttgtgggaaaaacaatttatatcaaagaagggcgttgctat
gatgcgaatggcacaattgcaggggcatcaatcacaatgatggaatccattaaaaatgcg
gtagaatatgttgaaattcctcttgcggaagccattagaatgagtaacctttatcctgca
cgagcaattggtatagatgatcgtttaggttcggtagaaaaaggtaagatagcaaactta
gccgtgtttacgccaaattaccaagtaatcggcacagtagtaaacggaaagtggaaagag
aattaa

DBGET integrated database retrieval system