KEGG   Haemophilus influenzae 723: NTHI723_01633Help
Entry
NTHI723_01633     CDS       T03722                                 

Definition
(GenBank) hypothetical protein
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
hix  Haemophilus influenzae 723
Pathway
hix00270  Cysteine and methionine metabolism
hix00450  Selenocompound metabolism
hix01100  Metabolic pathways
hix01110  Biosynthesis of secondary metabolites
hix01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hix00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NTHI723_01633
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NTHI723_01633
Enzymes [BR:hix01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     NTHI723_01633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2
Motif
Other DBs
NCBI-ProteinID: AJO92023
UniProt: A0A2S9RMI7
Position
complement(1640615..1640890)
Genome map
AA seq 91 aa AA seqDB search
MRGPYTSLVDLFESALPDILMLEFSTPRAGELSSLLESEILRQKCILGLGVINPRSDEVE
TVTQIVQRAEKALNYLPPEQISKFQTKKLPH
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgggccttatacatcattagtggatttatttgaatcggcattacctgatatttta
atgctcgaattttctacgccaagagcgggagaattaagttcgttattagaaagtgaaata
ttaagacaaaaatgtattttaggcttaggcgtcatcaatcctcgttctgatgaagtggaa
actgtaacacaaattgttcagcgcgcagaaaaagccttaaattaccttccaccagagcaa
atatcaaaatttcagacaaaaaaattgccccattaa

DBGET integrated database retrieval system