KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_0638Help
Entry
R2866_0638        CDS       T01981                                 

Gene name
amiB
Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
hiz01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:hiz00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    R2866_0638 (amiB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hiz01011]
    R2866_0638 (amiB)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hiz03036]
    R2866_0638 (amiB)
Enzymes [BR:hiz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     R2866_0638 (amiB)
Peptidoglycan biosynthesis and degradation proteins [BR:hiz01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   R2866_0638 (amiB)
Chromosome and associated proteins [BR:hiz03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    R2866_0638 (amiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 LysM
Motif
Other DBs
NCBI-ProteinID: ADO80599
Position
complement(630876..632174)
Genome map
AA seq 432 aa AA seqDB search
MKTKILFFLFFSTFSFSLFAAPITIAIDPGHGGKDPGAISRNLGIYEKNVTLSIAKELKA
LLDKDPHFRGVLTRKSDYYISVPERSEIARKFKANYLISIHADSSESPDRRGASVWVLSN
RRANDEMGQWLEDDEKRSELLGGAGKVLSHNNDKYLDQTVLDLQFGHSQRTGYVLGEHIL
HHFAKVTTLSRSTPQHASLGVLRSPDIPSVLVETGFLSNSEEEKKLNSQTYRRRIAYMIY
EGLVAFHSGKTNTLVKDNLVQNIKQNDIKKSGKNNRTSEQNINEDNIKDSGIRHIVKKGE
SLGSLSNKYHVKVSDIIKLNQLKRKTLWLNESIKIPDNVEIKNKSLTIKENDFHKKQNSS
VNNTNKDLKKEKNTQTNNQKNIIPLYHKVTKNQTLYAISREYNIPVNILLSLNPHLKNGK
VITGQKIKLREK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaaaattttattttttctttttttctcgacatttagcttttctctttttgca
gctccaattacgattgcgattgacccaggtcacggaggaaaagatcccggtgcaatcagc
cgaaatttaggcatttatgaaaaaaatgttaccctttcaattgcaaaagaattaaaagcc
ttattagataaagatccacattttcgtggcgtattaacacgtaaaagtgattattatatt
tccgtgcctgaacgttcagaaatcgcacgtaaatttaaagcgaattatcttatttccatt
catgcggattcatctgaatcgcctgatcgtcgtggggcttctgtttgggtattgtcaaac
cgtcgagccaatgatgaaatgggtcaatggctagaagacgatgaaaaacgctcggaatta
cttggtggagcgggaaaggtgctttcacacaataatgataaatacctagatcaaactgta
cttgatctgcaattcggacatagccaacgtacaggctatgtgttaggcgaacatattttg
caccattttgctaaagtaacaacattaagtcgcagtacgccacaacatgcaagtctgggt
gttctacgttcgccagatattccttctgtgttggtagaaacgggatttctttccaattca
gaagaagaaaaaaaacttaattcccaaacttatcgtcgccgcattgcttatatgatttat
gaaggcttagttgcattccatagcggtaaaaccaacactttagttaaagacaatttagtg
caaaacatcaaacaaaacgatataaaaaaatcagggaaaaataaccgcacttcagaacaa
aatataaatgaagataatattaaagacagtggcattcgccatattgtaaaaaaaggagaa
agtttaggcagcttatcaaataaatatcacgtcaaagtctctgatattattaaattaaat
caattaaagagaaaaacactttggctaaatgaaagtattaaaatccctgataatgtcgag
ataaaaaataaatcattaacaattaaagaaaatgattttcataaaaaacaaaatagctca
gtaaataataccaataaagatttaaaaaaagagaaaaatacacaaactaataatcaaaaa
aatataattccgctctatcataaagtaacaaaaaaccaaacactttatgctatttcgagg
gaatataacattccagtaaatatactattgagcctaaatccacatttaaaaaatggcaaa
gttattacaggacaaaaaataaaattaagagaaaaataa

DBGET integrated database retrieval system