KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_0753Help
Entry
R2866_0753        CDS       T01981                                 

Gene name
metE
Definition
(GenBank) 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
hiz00270  Cysteine and methionine metabolism
hiz00450  Selenocompound metabolism
hiz01100  Metabolic pathways
hiz01110  Biosynthesis of secondary metabolites
hiz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hiz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    R2866_0753 (metE)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    R2866_0753 (metE)
Enzymes [BR:hiz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     R2866_0753 (metE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2 Meth_synt_1
Motif
Other DBs
NCBI-ProteinID: ADO80706
Position
755176..757446
Genome map
AA seq 756 aa AA seqDB search
MTTSHILGFPRVGAKRELKFAQERYWRKELAEQDLLDLAKALREKNWKHQAAANADFVAV
GDFTFYDHILDLQVATGAIPARFGFDSQNLTLDQYFQLARGNKDQFAIEMTKWFDTNYHY
LVPEFQKSTAFKANPAHYVNQIREAKALGLNFKPVIVGPLTFLWLGKEKGEAFNRFDLLN
QLVPVYVEILNALVAEGAEWIQIDEPALALDLPAEWVEAYKSVYTELSKVNAKLLLATYF
GSVAEHAELLKALPVAGLHLDLVRAPEQLAAFEDYSKVLSAGVIEGRNIWRANLNKVLDV
LEPLKAKLGERLWIAPSCSLLHTPFDLEVEVQLKEKNTALYSWLSFTLQKVEELNVLKQA
LNNGRASVQAALDASQVAADARATSKEIHRPEVAERLANLPKGADQRKSPFAERIVKQNA
WLNLPLLPTTNIGSFPQTTEIRHARASFKKGELSLADYEAAMKKEIEYVVRRQEELDLDV
LVHGEAERNDMVEYFGELLDGFAFTKFGWVQSYGSRCVKPPVIYGDVIRPEPMTVRWSQY
AQSLTNRVMKGMLTGPVTILQWSFVRNDIPRSTVCKQIGVALSDEVLDLEAAGIKVIQID
EPAIREGLPLKRADWDAYLQWAGEAFRLSSMGVQDDTQIHTHMCYSEFNDILPAIAALDA
DVITIETSRSDMELLTAFADFKYPNDIGPGVYDIHSPRVPTATEVEHLLRKALNVIPKER
LWVNPDCGLKTRGWTETIDQLKVMVDVTKKLRAELA
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatcacatattttaggctttcctcgtgtaggggcaaaacgtgaattaaaattc
gcacaagaacgttattggcgtaaagaattagcagagcaagatttattagatttagcgaaa
gcgttgcgtgaaaaaaactggaaacatcaagcagcggcgaatgcggatttcgttgcagtg
ggcgatttcacgttctacgatcatattttagatttacaagtggcaacaggggcaattcct
gctcgttttggttttgatagccaaaatttaacccttgatcaatatttccaacttgcacgt
ggtaacaaagatcaattcgcaattgaaatgaccaaatggtttgatacgaactatcactat
cttgtgcctgagttccaaaaatcgaccgctttcaaagctaatccagcacattatgtaaac
caaatccgtgaagcaaaagcgttaggcttaaacttcaaacctgtgattgttggcccatta
acattcttatggttaggtaaagaaaaaggcgaagcatttaaccgtttcgatttattaaat
caattagtgcctgtttatgttgaaatattaaatgcattagtggctgaaggggcagagtgg
attcaaattgatgaacctgcattagcattagatttaccagcagaatgggttgaagcctat
aaatctgtttacactgaattaagcaaagtgaacgcaaaattattattagccacttatttt
ggttcagttgcagaacacgctgaattattaaaagccttacctgttgcaggcttgcattta
gatttagttcgtgcaccagaacaacttgcggcatttgaagattacagcaaagtgttatca
gctggtgtgattgaaggtcgtaatatctggcgtgcaaacttaaacaaagtgttagatgta
ttagagccattaaaagcaaaattaggtgagcgtttatggattgcaccaagctgttcatta
ttgcataccccatttgatttagaagtggaagtacaattaaaagaaaaaaataccgcactt
tacagctggttatctttcacgctacaaaaagtagaagaattaaacgtattaaaacaagcg
ttaaataatggcagagcgtctgtacaagctgcattagatgcaagccaagtggcagcagat
gcacgcgcaacgtcaaaagaaattcatcgccctgaagtggcagaacgtttagcaaacttg
ccaaaaggtgcggatcaacgtaaatcgccatttgcagaacgtatcgttaagcaaaatgcg
tggttaaatttaccgcttctgccaactacaaacattggttcattcccacaaacgacagaa
attcgtcacgcacgtgcaagtttcaaaaaaggcgagttatctcttgcagattacgaagca
gcaatgaaaaaagaaatcgaatatgtcgtgcgtcgccaagaagaattagatttagatgtg
ttagttcacggtgaagcagaacgtaacgacatggtggaatactttggggaattattagat
ggtttcgcattcactaaatttggttgggtacaaagctacggttcacgttgtgtaaaacca
ccagtaatttacggtgatgttatccgccctgagccaatgacagtacgctggtcacaatat
gcgcaaagtttaactaaccgtgtaatgaaaggaatgctcacaggccctgtgactatttta
caatggtcattcgtgcgtaatgatattccacgttcaaccgtatgtaaacaaatcggcgta
gcgttatctgatgaagtgttagatttagaagcagcaggcattaaagtcattcaaattgac
gaaccagccattcgtgaaggtttaccgcttaaacgtgcagattgggatgcatacttacaa
tgggcaggcgaagcattccgtttaagctcaatgggcgtgcaagatgatacgcaaattcac
actcacatgtgttattccgagtttaacgacatcttacctgccattgcggcattagatgca
gacgtgattactatcgaaacttcacgttcagatatggaattattaaccgcatttgcagat
ttcaaatatccaaatgatattggcccaggtgtttatgatattcacagccctcgtgtgcca
acggcaacggaagtagaacatttattacgcaaagcattaaatgtcattccaaaagaacgc
ttatgggtaaacccagactgcggtttaaaaacgcgtggttggacagaaaccatcgaccaa
ttaaaagtgatggtggatgtaaccaaaaaattacgtgcggaattagcgtaa

DBGET integrated database retrieval system