KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1401Help
Entry
R2866_1401        CDS       T01981                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
hiz00010  Glycolysis / Gluconeogenesis
hiz00030  Pentose phosphate pathway
hiz00051  Fructose and mannose metabolism
hiz00052  Galactose metabolism
hiz00680  Methane metabolism
hiz01100  Metabolic pathways
hiz01110  Biosynthesis of secondary metabolites
hiz01120  Microbial metabolism in diverse environments
hiz01130  Biosynthesis of antibiotics
hiz01200  Carbon metabolism
hiz01230  Biosynthesis of amino acids
hiz03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hiz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    R2866_1401 (pfkA)
   00030 Pentose phosphate pathway
    R2866_1401 (pfkA)
   00051 Fructose and mannose metabolism
    R2866_1401 (pfkA)
   00052 Galactose metabolism
    R2866_1401 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    R2866_1401 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    R2866_1401 (pfkA)
Enzymes [BR:hiz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     R2866_1401 (pfkA)
Protein phosphatases and associated proteins [BR:hiz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     R2866_1401 (pfkA)
Messenger RNA biogenesis [BR:hiz03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     R2866_1401 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADO81336
Position
1443067..1444032
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQLNRYSVSD
VINRGGTFLGSARFPEFKDPNIRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHSFP
CVGLPGTIDNDVAGTDYTIGYQTALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
SAGIAGGCEYIVASEIEFNREELIQQIERSIIRGKRHAIIAITELLTDVHSLAKEIEARV
GHETRATVLGHIQRGGSPCAFDRILASRMGAYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMQRVFKADWLKVAKRLE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgcagttttaacaagtggtggcgatgcgcctggtatgaatgccgca
attcgtggcgtagtacgttctgcacttgcagaaggcttagaagtgtttggtatctatgat
ggttatcaaggtttatacaataataaaatcaaacaattaaatcgctatagcgtatctgat
gtcattaatcgtggcggtacttttttaggctctgcacgttttcctgaatttaaagatcct
aatattcgggcaaaatgtgcggaaattttacgttctcacggcattgatgcacttgtggtt
atcggtggtgacggctcttatatgggagctaaattattaaccgaagaacacagtttccct
tgtgttggcttacccggtactattgataatgatgttgcaggtactgactataccatcggc
tatcaaaccgcattacaaactgcagtggatgcaatcgaccgtttacgtgatacatcaagc
tcacaccaacgtatttctattgttgaaattatgggtcgtcattgtagtgacttaaccatt
tctgcggggatcgctggcggttgcgaatatatcgtcgcatcagaaattgaatttaatcgc
gaagaattaattcaacaaattgaacgtagcattattcgtggtaaacgccacgctattatt
gcaatcactgaacttttaaccgatgttcattctctcgcaaaagaaattgaagctcgcgta
ggccatgaaactcgcgcaactgttttagggcatattcaacgtggtggttctccttgtgct
tttgaccgtattcttgcctcacgtatgggtgcatatgcagtagatttattgctacaaggc
aaaggcggctattgcgtaggcatccaaaatgaacaacttgttcatcacgatattattgat
gccattaataatatgcagcgtgtatttaaggctgattggcttaaagtggcaaaacgtttg
gaataa

DBGET integrated database retrieval system