KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1623Help
Entry
R2866_1623        CDS       T01981                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
hiz00071  Fatty acid degradation
hiz00280  Valine, leucine and isoleucine degradation
hiz00310  Lysine degradation
hiz00380  Tryptophan metabolism
hiz00620  Pyruvate metabolism
hiz00630  Glyoxylate and dicarboxylate metabolism
hiz00640  Propanoate metabolism
hiz00650  Butanoate metabolism
hiz00900  Terpenoid backbone biosynthesis
hiz01100  Metabolic pathways
hiz01110  Biosynthesis of secondary metabolites
hiz01120  Microbial metabolism in diverse environments
hiz01130  Biosynthesis of antibiotics
hiz01200  Carbon metabolism
hiz01212  Fatty acid metabolism
hiz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hiz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    R2866_1623 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    R2866_1623 (atoB)
   00640 Propanoate metabolism
    R2866_1623 (atoB)
   00650 Butanoate metabolism
    R2866_1623 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    R2866_1623 (atoB)
   00072 Synthesis and degradation of ketone bodies
    R2866_1623 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    R2866_1623 (atoB)
   00310 Lysine degradation
    R2866_1623 (atoB)
   00380 Tryptophan metabolism
    R2866_1623 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    R2866_1623 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    R2866_1623 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    R2866_1623 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hiz04147]
    R2866_1623 (atoB)
Enzymes [BR:hiz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     R2866_1623 (atoB)
Exosome [BR:hiz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   R2866_1623 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADO81552
Position
1654976..1656157
Genome map
AA seq 393 aa AA seqDB search
MENVVIVSAVRTPIGSFNGALSSVSAVDLGAIVIQEAIKRANIESALVNEVIMGNVLQAG
LGQNPARQAALKAGIEKEIPSLTINKVCGSGLKSVALGAQSIISGDADIVVVGGMENMSQ
APYLLDSKVRQGVKMGNLTLRDTMIEDGLTCASNHYHMGITAENIAEQYGISRQAQDELA
LRSQTLASQAVQLGVFDKEIVPVMVKTRKGDIIVSRDEYPKADTTAEGLAKLKPAFKKEG
TVTAGNASGINDGAAALILVSESKAHALGLKAIAKIRSYASGGVDPSVMGLGPVPATQKA
LKKAGINLDDIDLIEANEAFASQFLGVGKDLNLDMNKTNIHGGAIALGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGQGISMIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgttgttattgttagtgcagttagaacaccgatcggcagctttaatggtgca
ttatcttccgtaagtgcggttgatttaggtgcaattgtgatacaagaagccatcaaacgt
gccaacattgaaagtgcattagttaatgaagtcatcatggggaacgtattacaagcagga
ctaggacaaaatccagcccgtcaagcagcattaaaagcaggaatagagaaagaaatccct
tctttaacaatcaataaagtatgtggatctggtctaaaaagtgtcgcattaggtgcacag
tctattatcagtggtgatgctgatattgttgttgtgggaggcatggaaaatatgagccaa
gcaccttatcttttagatagcaaagtacgacaaggcgtcaaaatgggtaatctcacatta
agggacacaatgattgaagacgggctaacttgtgctagcaatcactatcatatggggatt
actgccgaaaatattgcagaacaatatggtattagccgccaagcacaagatgaactcgca
ttacgttcacaaaccttagcatctcaagccgtgcaattaggtgtatttgataaggaaatt
gtccctgttatggtaaaaactcgcaaaggtgacattattgtttcacgagacgagtatcct
aaagcagatactacagctgaaggtttagctaaattaaaacctgctttcaaaaaagagggt
actgtcaccgcaggtaacgcttctggcattaatgatggtgctgcagcacttattttagtt
agcgaaagcaaagctcatgcacttggattaaaagccattgcaaaaattagaagttatgcc
agcggtggggtagatccatctgttatgggattaggtccagttccagcaacgcaaaaagca
ttgaaaaaagcaggaataaatcttgatgatatcgatctgatagaagcaaatgaagccttt
gcctcacagttcttaggtgttggcaaagatctcaatttggatatgaataaaaccaatatt
catggtggagctatcgcacttgggcatccaatcggtgcgagtggtgcaaggattttagta
acgttattgcacaatcttatcgaaaaagataaaaaacttggacttgctacactttgtatt
ggcggtggtcaaggtatttctatgattgtagaacgcttataa

DBGET integrated database retrieval system