KEGG   Halioglobus japonicus: BST95_01785
Entry
BST95_01785       CDS       T04687                                 

Definition
(GenBank) hypothetical protein
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
hja  Halioglobus japonicus
Brite
KEGG Orthology (KO) [BR:hja00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BST95_01785
Enzymes [BR:hja01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     BST95_01785
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-ProteinID: AQA17134
UniProt: A0A2N5Y9H5
Position
complement(375602..376495)
AA seq 297 aa
MADSQRVLVVGGTHGNEVTGVHLVRRLQRNPQELTRDSFTAQTLLANLPAMAANRRYLEQ
DLNRCFTAALLNSEPQNGEQVLAHEINEKYGPKGADSPTDWIIDLHTTTANMGVTLVVQQ
HDPQAVDMALYVQQKMPDVVIFDENCTRDEDPFLCSIGQHSMLIEVGPVPQGLLRWDVFE
QTARALAHALDFIDLRARGEDSLPSPRQADMYQFIEKLHLPRDEHGAICGMIHPELQDRD
YRELSPGDPIFISVDGETIPFDYPESVHVAFVNEAAYYDQAHGLSLMRKRTVSWEGE
NT seq 894 nt   +upstreamnt  +downstreamnt
atggctgattcccagcgcgtgttggtcgtcggtggtacacacggcaatgaggtgactggc
gtacaccttgtccggcgcctgcagcgcaatccacaggagctcacacgcgatagctttacg
gcacaaaccctgctcgccaatttgcccgctatggcggccaatcggcgctatctggagcag
gatctgaatcgctgcttcactgcggcgctgctgaacagcgagccccagaacggcgagcag
gtgctggcgcacgagattaacgaaaagtatgggcctaaaggggcggatagcccgaccgac
tggattatcgacctgcataccaccaccgctaatatgggagtcaccctggtggtgcagcag
cacgaccctcaggcggtggatatggcgctttatgtgcagcaaaaaatgcccgatgtggtg
attttcgatgagaactgcacacgcgatgaagaccccttcttgtgttcgattggccagcac
agcatgctcatcgaggtggggcctgtaccgcagggcctgctgcgctgggacgtgttcgag
caaaccgcccgtgccctcgcgcacgccctggatttcattgacttgcgtgcccgaggcgaa
gatagcttaccctcgccgcggcaggcggatatgtatcagtttatcgagaagctgcatctg
ccccgtgatgaacatggcgccatctgcggcatgattcaccccgagttacaggatcgcgac
taccgtgaattgtcgcccggggatccgatatttatcagcgtggacggggagaccattccc
tttgactatcccgagagtgtccatgttgcatttgtgaatgaggcggcctattacgatcag
gcccatggcctctcgctaatgcgcaaaagaaccgtgagctgggaaggcgagtaa

DBGET integrated database retrieval system