KEGG   Halioglobus japonicus: BST95_02510Help
Entry
BST95_02510       CDS       T04687                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hja  Halioglobus japonicus
Brite
KEGG Orthology (KO) [BR:hja00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BST95_02510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: AQA17261
UniProt: A0A2N5Y9X0
Position
524873..526153
Genome map
AA seq 426 aa AA seqDB search
MEIIAEYGTVFLIMACMFGFFMAWGIGANDVANAMGTSVGSRALTIKQAIFIAMIFEFLG
AYLAGGEVTSTIRKGIIDADVMADDPQLMVYGMMSALLAAGTWLLVASMKGWPVSTTHSI
VGAIVGFAAVGISAESVHWDKVGSIVASWVVSPVLAGTISFGLFMSVKWLILDTDDPFNR
AKKYIPIYMWMVGFMISMVTLLKGLKHVGLDLDLGLGSKFANALPVSAVIGLLVAGLGAL
LLRNISDDEDHENRFGSVERVFAVLMVFTACAMAFAHGSNDVANAVGPLAAIASTVQSGG
EIAAKSAMPWWILLVGAAGIVVGLATYGWRVITTVGRKITELTPSRGFAAELGAAATVVL
ASATGLPISTTHTLVGAVLGVGFARGIAALNLRVVGTIFMSWIITLPAGAGLAILFFFIF
KAMFGA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggaaattatcgcagagtacggcacggtctttctgatcatggcctgcatgtttggcttc
ttcatggcctggggaatcggtgccaatgacgtggccaatgccatgggcacctctgtcggc
tcacgcgccctcacgattaagcaggcgatctttatcgccatgattttcgagttcctcggg
gcctatttggcgggtggcgaggtcacctcgacgatacgtaagggcattattgatgccgac
gtaatggcggatgacccgcagctaatggtctacgggatgatgtccgcgctattagctgca
ggtacctggctgctggtcgcgagtatgaagggctggccagtgtccaccacccactccatc
gtcggcgccatcgtgggctttgcagcggtgggtatttcggccgaatctgttcactgggac
aaggtcggcagcattgtggcttcctgggtggtatcacctgtgctcgcaggcacgatttcc
ttcggcctgttcatgagtgtgaagtggctcattctggataccgacgacccctttaaccgc
gccaagaagtacatccccatctacatgtggatggtcggcttcatgatctccatggtcacc
ctgctcaagggcctgaaacatgttggccttgatctggatctgggactgggcagtaagttc
gccaatgcgctgcccgtatcggccgtgatcggcctgctggttgcgggtctcggcgccctg
ctgctgcgcaacatcagcgacgacgaggaccacgagaatcgctttggcagcgttgaaaga
gtctttgccgtgctgatggtattcaccgcctgtgccatggccttcgcccacgggtcaaac
gacgtggccaacgcggtgggtcccctcgccgctattgccagcaccgtacagtcaggcggc
gagatcgctgcaaaatccgccatgccctggtggattctgctggtcggcgccgcgggtatt
gttgttggcctcgccacctatggctggcgcgttatcaccaccgtgggtcgcaagatcacc
gagctcacccccagccgcggttttgccgcagagcttggcgccgccgccaccgtggtgctt
gcttcggcaacaggcctgcccatctcgaccacacacacacttgtgggcgcggtactcggt
gtaggtttcgccagaggcattgccgcgctcaacctgcgcgtggtgggcaccatctttatg
tcctggattattaccctgccagccggtgccggcttggccattctgttcttcttcatcttc
aaggccatgttcggcgcctga

DBGET integrated database retrieval system