KEGG   Halioglobus japonicus: BST95_16320Help
Entry
BST95_16320       CDS       T04687                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hja  Halioglobus japonicus
Pathway
hja00071  Fatty acid degradation
hja00072  Synthesis and degradation of ketone bodies
hja00280  Valine, leucine and isoleucine degradation
hja00310  Lysine degradation
hja00362  Benzoate degradation
hja00380  Tryptophan metabolism
hja00620  Pyruvate metabolism
hja00630  Glyoxylate and dicarboxylate metabolism
hja00640  Propanoate metabolism
hja00650  Butanoate metabolism
hja00900  Terpenoid backbone biosynthesis
hja01100  Metabolic pathways
hja01110  Biosynthesis of secondary metabolites
hja01120  Microbial metabolism in diverse environments
hja01130  Biosynthesis of antibiotics
hja01200  Carbon metabolism
hja01212  Fatty acid metabolism
hja02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BST95_16320
   00630 Glyoxylate and dicarboxylate metabolism
    BST95_16320
   00640 Propanoate metabolism
    BST95_16320
   00650 Butanoate metabolism
    BST95_16320
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BST95_16320
   00072 Synthesis and degradation of ketone bodies
    BST95_16320
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BST95_16320
   00310 Lysine degradation
    BST95_16320
   00380 Tryptophan metabolism
    BST95_16320
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BST95_16320
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BST95_16320
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BST95_16320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hja04147]
    BST95_16320
Enzymes [BR:hja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BST95_16320
Exosome [BR:hja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BST95_16320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AQA19565
Position
3464951..3466207
Genome map
AA seq 418 aa AA seqDB search
MTVELSKLPTNTPIIVGAGQSVERDAGSTSHVGMAARAAAMAVKDTGAQGIADSIDTIAM
IRLFSDIAPAWQANLGRSNNPPESIARAIGAKPRHRIYSQAGGNEPQALLMEFFADISRG
DRDMVLLAGAEALRNQRKAEKQGLALDWAEDYDEPLEDRGIGNIFPDPQELANGMIMPLH
YYTLIEQARRTAMGQDRQGYLAESARLMASFSEIASHNPYSQWPGAQSADDILQADLLTH
LYTKRMIAQDSVNQGAALLLTSVGKARELGIPEDNWIFMHGAAEGTDVDVSVRPTLGGSV
VAGHVLDTALAMAGRSHNSIDMFDIYSCFPCAVTAISDHLHLPADGSLPLTLTGGLPFFG
GPATTTACTGWQKPSGNCAKRPGSLPWCMPMVAFLPNMPRAYFPVLPVRSTGRQRTRR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtagaactttcgaaactccccaccaatacacccattatcgtgggggccgggcaa
agcgttgaacgcgacgcgggcagcacgtcacacgtcggcatggctgcccgggctgccgcc
atggccgtcaaggataccggcgcgcagggcattgcagacagtatcgacaccattgccatg
attcggctgttctcggatattgcacctgcgtggcaggccaacctgggacgcagtaataac
ccgcccgaatccattgccagggccattggcgccaagccccgccaccgcatctactcacag
gccggcggcaacgagccacaggcactgctgatggaatttttcgccgacatatcccggggc
gacagggacatggtgctgctggcaggcgccgaggccttgcgcaaccaacgcaaggccgaa
aagcagggccttgcgctcgactgggctgaagattacgacgagcctctggaagaccgtggt
attgggaatattttcccggacccacaagaactggccaatggcatgatcatgccgctgcac
tactacacccttatagaacaggcccggcgcaccgccatggggcaggatcgccagggctac
ctggcggaatctgccaggctcatggcgtccttcagtgagatcgcctcccacaacccttac
tcccagtggcctggggcacagtctgccgacgacattctccaggcagacctgcttactcat
ctctacaccaagcggatgattgcccaggacagcgtgaatcaaggcgctgcgctactgctt
accagtgtgggcaaggcacgcgagctcggcattcccgaggacaattggatatttatgcac
ggggccgcggaaggaacggatgtcgacgtgagcgtacgcccgacactgggtggctctgtg
gtagcgggtcatgttctcgatactgcactggctatggctggccgctcacataacagcatc
gacatgttcgacatttacagttgcttcccctgtgctgtcactgctatcagcgaccacctg
cacttgcccgcagacggctccctgcctctcacgcttaccggcggcctgcccttctttggt
ggcccggcaacaactacagcatgcacgggctggcagaaaccgtctggcaactgcgcaaag
cgcccgggaagtttgccttggtgcatgccaatggtggctttcttaccaaacatgccacgg
gcatattttccggtactgccagtacggtcgactggtcggcagcgaacacgaagatag

DBGET integrated database retrieval system