KEGG   Halalkalicoccus jeotgali: HacjB3_00130Help
Entry
HacjB3_00130      CDS       T01271                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00010  Glycolysis / Gluconeogenesis
hje00020  Citrate cycle (TCA cycle)
hje00620  Pyruvate metabolism
hje01100  Metabolic pathways
hje01110  Biosynthesis of secondary metabolites
hje01120  Microbial metabolism in diverse environments
hje01130  Biosynthesis of antibiotics
hje01200  Carbon metabolism
Module
hje_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HacjB3_00130
   00020 Citrate cycle (TCA cycle)
    HacjB3_00130
   00620 Pyruvate metabolism
    HacjB3_00130
Enzymes [BR:hje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HacjB3_00130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADJ13419
UniProt: D8J3S8
Position
29564..31078
Genome map
AA seq 504 aa AA seqDB search
MVREFKLPDVGEGVAEGEIVQWLVSEGDEVSEDQPVAEVETDKAVVEVPSPVDGSVKEIL
AEEGEVVPVGNVIITFAVEGEEEETAESEAPTHSQERVSEEPAEIGEEDETETPAGRTFA
PPNVRRLARELGVDISSVSGSGPSGRVTEGDVREAAEGGNEETKGPKQLDEGLPSATRKA
GEEGGSATGADTADLESADRDRTLAAPATRKLAEEEGVDLNRVPTDEERDGEAFVTPEAV
RQYATAQREAQAADAAAVAESGTEASTGGEPTGSEERLPYRGIRRTIGRQMANSKFTAPH
VSHHDTADVKRLVEARADLKDRAEDRGVKLTYMPFIMKAIVAALKEFPELNASLDEEAEE
IVVKHYYNIGIAVATDAGLMVPVVRNVDEKGLLQLASEVNELAQKARERSISREEMQGGT
FTITNFGAIGGEYATPIINHPEVGILGLGKLTERPVAEDGEVRAAHTLPLSLSIDHRVID
GAEAAMFANRVIEYLENPTLLLLE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcgagttcaaactgcccgacgtcggcgagggcgtcgcggagggcgagatcgtc
cagtggttggtctcggaaggcgacgaagtcagcgaggaccagccggtcgcggaggtcgag
acggacaaagcggtcgtcgaggtcccctcgccggtcgacggttcggtaaaggagatcctc
gccgaggagggcgaggtcgtccccgttggaaacgtcatcatcacgttcgcggtggaaggc
gaggaagaagaaacggccgagagcgaagcaccgacgcactcccaagaacgggtcagcgag
gaaccggcggagatcggtgaggaggacgaaaccgaaacgcccgcagggcgaacgttcgcc
ccgccgaacgtccgacgactggcccgcgaactcggcgtcgatatttcgagcgtgtcgggc
tcgggcccaagtggccgggtcaccgagggggacgtgcgcgaggccgcggaagggggcaat
gaggaaacaaagggaccgaaacagctcgacgagggactgccgtcggcgacccggaaggcg
ggcgaggaggggggttcggctaccggggccgacaccgcagacctcgaatcggcggatcga
gaccggacgctggccgcacccgcgacacggaagctcgccgaggaggaaggcgtcgacctg
aaccgagtcccgaccgacgaggagcgcgacggcgaggcgttcgtcacgcccgaggcggtc
cgacagtacgcgaccgcccagcgcgaggcacaggctgccgacgccgcggctgtcgcggaa
agcgggaccgaagccagcacaggaggcgaaccgacgggaagcgaggagcgccttccctac
cgggggatccgccggacgatcggccgtcagatggcgaactcgaagttcaccgccccgcac
gtcagccatcacgacaccgccgatgtgaagaggctcgtcgaggcgcgcgccgatctgaaa
gatcgcgccgaggaccggggtgtgaaactgacctacatgcccttcatcatgaaggcgatc
gtcgccgccctgaaggagttccccgaactgaacgcctcactcgacgaggaggcagaagag
atcgtcgtcaagcactactacaacatcggcatcgccgtcgccacggacgcgggcctgatg
gttcccgtcgtaaggaacgtcgacgagaaggggctcctccagctggcgtcggaagtgaac
gaactcgcccagaaggcccgcgagcgctcgatcagtcgggaggagatgcagggcggcacg
ttcacgatcacgaacttcggggcgatcggcggggagtacgccaccccgatcatcaaccat
cccgaagtcggcattttgggcctcggaaagctgaccgagcgcccggtcgccgaggacggt
gaggtgcgggcggcccacacgctgccgctgtcgctgtcgatcgaccaccgcgtgatcgac
ggggcggaggcggccatgttcgcgaaccgcgtgatagagtacctagagaacccaacgctg
ctgctactagaataa

DBGET integrated database retrieval system