KEGG   Halalkalicoccus jeotgali: HacjB3_04295Help
Entry
HacjB3_04295      CDS       T01271                                 

Definition
(GenBank) putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00790  Folate biosynthesis
hje01100  Metabolic pathways
hje04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:hje00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HacjB3_04295
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    HacjB3_04295
Enzymes [BR:hje01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     HacjB3_04295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaE MobB TPR_15
Motif
Other DBs
NCBI-ProteinID: ADJ14250
UniProt: D8J8R5
Position
complement(844449..845264)
Genome map
AA seq 271 aa AA seqDB search
MHVLGIVGTADVETTRLVETLTDRLADRGRVATIASTRSEMSKATGPTYRESGATSSYEL
SEDGWTGAGENRTLAETLDDLAPTHEYALVEGFPEAAIPQVVLGDAEYAGEAIAMGDRGD
AIDPEGAIDALEASEPYVTLESLVRRAKGSPRADRAGAIATFTGRVRKKDSADDAPTEFL
EFETYEGVAQQRFTTIREELEAREGIYEVLMHHRTGVIEAGADIVFVVVLAGHRKEAFRA
VEDGIDRLKDEVPIFKKEVTADEEFWVHTRV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtcctcgggatcgtcggcaccgccgacgtggaaacgacgcgactcgtcgaaacg
cttaccgaccgtctcgccgaccgcggccgcgtcgccacgatcgccagcacccgctcggag
atgagcaaggcgacgggccccacctaccgcgaatccggggccacgagtagctacgaactg
tccgaggacggttggaccggcgccggcgagaaccgaaccctcgccgagacgctcgatgac
ctcgcgccgacccacgagtacgccctcgtcgaggggtttcccgaggcggcgattccgcag
gtcgtgctgggtgacgccgagtacgccggcgaggcgatcgcgatgggtgaccgcggggac
gctatcgatcccgagggtgccatcgacgccctcgaagcgtccgaaccgtacgtcaccctc
gagtcactagttcggcgcgcgaagggttctccacgggccgaccgtgcgggtgcgatcgcg
acgttcactgggagggtacggaagaaggactcggccgacgacgcacccaccgagttcctg
gagttcgagacctacgaaggggttgcacaacagcgcttcacgacgatccgcgaggaactc
gaagcgcgcgagggcatctacgaggtcctgatgcaccaccggacgggcgtgatcgaggcg
ggcgcggacatcgttttcgtggtcgtgctcgcgggccaccgcaaggaggcgtttcgggcg
gtcgaggacggaatcgaccggctcaaggacgaggtcccgatcttcaaaaaggaagtgacg
gccgacgaggagttctgggtccacacccgcgtttga

DBGET integrated database retrieval system