KEGG   Halalkalicoccus jeotgali: HacjB3_07585Help
Entry
HacjB3_07585      CDS       T01271                                 

Definition
(GenBank) threonine/homoserine/homoserine lactone efflux protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysE TerC PTR2 Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: ADJ14902
UniProt: D8J2E5
Position
complement(1409712..1410221)
Genome map
AA seq 169 aa AA seqDB search
MAALGSSAGSIVHTTGAVLGLSAVLQTSAVAFTVVKFVGAAYLVYLGIQTFRKPDEFEIS
PESTSYTPTESFQSALLINVLNPKVAVFFLAFLPQFVQPGSSVTLQIFTFGVLFASLGFV
YQAVLAVFSARARHVISERDLVQTLLRTASGSVLIGFGLKLALEERTAP
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggccgcactgggctcatcagccggaagtatcgttcacacgacaggagctgtattgggg
ctctcggctgttctgcaaacgtcggcggtggcgtttaccgtcgtcaaattcgtcggtgcg
gcgtatctcgtctatctcggcattcagacgttcagaaagccggatgagttcgaaatatca
ccagagagtaccagctatacgccgacggagtcgtttcagagcgcgctcctcatcaacgtc
ttaaaccccaaagtagctgtattcttcctcgctttccttccacaatttgttcaaccggga
agtagcgttaccctccagatattcacgttcggcgtactctttgccagtcttgggttcgtc
tatcaagcagtgcttgcagtcttctcagcgcgggcacggcacgtgatctccgaacgcgat
ctcgtccaaacactacttcgtacggcaagtgggagtgttctgatcggattcggtctgaaa
ctcgcacttgaggaacgaactgctccgtag

DBGET integrated database retrieval system