KEGG   Halalkalicoccus jeotgali: HacjB3_07730Help
Entry
HacjB3_07730      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HR_lesion DoxX DUF4203
Motif
Other DBs
NCBI-ProteinID: ADJ14931
UniProt: D8J2H4
Position
1437387..1437761
Genome map
AA seq 124 aa AA seqDB search
MNDDTPSLLGRLLFGGSLAALAYGNFQELEAMIGYADSKDVPEADRLVPFASGMLAFGSL
AVILWRVPRLAAGAIAGFLVGVTPLMHDFWNAEGQERDTEQTNFLQNVALLGAALVFLGR
ADDD
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgacactccgtcgctgctcggccggctcctgttcggcgggagcctcgccgcg
ctagcctacggcaacttccaagaactcgaagcgatgatcggctacgccgactcgaaggac
gtcccagaggccgaccgtctggtgcctttcgccagcgggatgctcgccttcggcagcctc
gcggtgatcctctggcgggtcccgcgactcgccgccggcgcgatcgccggcttcctcgtc
ggagtcacgccgctgatgcacgacttctggaacgcggaaggacaggagcgcgataccgaa
cagacgaacttcctacagaacgtcgcgctgctcggtgcggcgctcgtcttcctcgggcga
gccgacgacgactga

DBGET integrated database retrieval system