KEGG   Halalkalicoccus jeotgali: HacjB3_07755Help
Entry
HacjB3_07755      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
  KO
K06199  fluoride exporter
Organism
hje  Halalkalicoccus jeotgali
Brite
KEGG Orthology (KO) [BR:hje00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hje02000]
    HacjB3_07755
Transporters [BR:hje02000]
 Other Transporters
  Pores ion channels [TC:1]
   HacjB3_07755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CRCB AFOR_N
Motif
Other DBs
NCBI-ProteinID: ADJ14936
UniProt: D8J2H9
Position
1440698..1441060
Genome map
AA seq 120 aa AA seqDB search
MASRPATLALVATGGFLGAMARYGVALLGPGLAGTFLANVTGCLALGYVFYTAAATERIS
PETRLFVATGFLSSYTTYSTFALQTTEASPAWGVLNVLGNYACGFVAVVLGRRLALGEWR
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccgaccggccaccctcgcgctcgtcgcgaccggcggtttcctcggcgcgatg
gcccgatacggtgtggcgctactcgggccggggctggcggggacgttcctcgccaacgtc
accggctgtctcgccctcgggtacgtcttttacaccgcggccgccaccgagcggatctca
ccggagacgcgactgttcgtcgcgaccgggtttctctcctcgtacaccacctacagcacg
ttcgcccttcagacgaccgaggcctcgcccgcgtggggggttctcaacgtgctcgggaac
tacgcctgtggctttgtcgccgtcgtcctcggccggcgactcgccctgggtgagtggcga
tga

DBGET integrated database retrieval system