KEGG   Halalkalicoccus jeotgali: HacjB3_07780Help
Entry
HacjB3_07780      CDS       T01271                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADJ14941
UniProt: D8J2I4
Position
complement(1443638..1444405)
Genome map
AA seq 255 aa AA seqDB search
MQVTDDAGIQRITFDRPDALNAFTTDAAAELADVLSGADPTEFDAIVLTGAGRAFSAGGD
VESMATREETPEEAYERIDETFGRLAEEALSCRVPIVAQVNGDAVGAGMAIVALTDFAYA
VESARFSAAFVRVGLIPDTGGTFLLPRLVGLRAAKDLAFTGRFFDAGEAADLGLVNGVVG
EDQLDDRIDDLLDTLRERPTRTIGLAKRTIHANLGRGFEEALDYENVVQSQAYGTQEHGE
GVDAFLADRDPEFHS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcactgacgacgcggggattcaacggatcaccttcgaccgccccgacgccctg
aacgcctttacaaccgacgccgcggccgaactcgccgacgtcctgtccggcgccgacccc
accgagttcgacgcgatcgtactcacgggcgcgggccgggcgttcagcgccggcggcgac
gtcgaatcgatggccacccgcgaggaaactcccgaggaggcctacgagcgcatcgacgag
acgttcggtcggctggctgaggaggcactctcctgtcgggtgccgatcgtcgctcaggtc
aacggcgacgccgtcggagccggtatggccatcgtcgcgctcaccgacttcgcctacgcc
gtcgagtcggctcgcttcagcgccgcgttcgtccgcgtggggctgatccccgacaccggc
gggacctttctgttgccccggctcgtcggcctgcgagcggcgaaggacctggcctttacg
ggccggtttttcgatgccggggaggcggccgacctcggcctagtcaacggggtcgtcggg
gaggaccaactggacgaccggatcgacgacctgctcgacaccctccgggagcgcccgacg
agaaccatcgggctcgccaagcggacgatccacgcgaacctcggacgcgggttcgaggag
gcgctcgactacgagaacgtcgtccagtcacaggcctacggcacgcaagaacacggcgag
ggcgtcgatgcgttcctcgcggatcgcgaccccgagtttcactcgtag

DBGET integrated database retrieval system