KEGG   Halalkalicoccus jeotgali: HacjB3_07805Help
Entry
HacjB3_07805      CDS       T01271                                 

Definition
(GenBank) transcriptional regulator, TrmB
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrmB HTH_24 GntR HTH_20 HTH_IclR HTH_5 HTH_Crp_2 Rrf2 DUF3489 MarR_2 TetR_C_24
Motif
Other DBs
NCBI-ProteinID: ADJ14946
UniProt: D8J2I9
Position
1448846..1449385
Genome map
AA seq 179 aa AA seqDB search
MSENDPDDGEEIPVTIDTEEGTDARTRIGEGADRAVEEFDKGIVDLLAWVLDTETRARIY
VYLRQYPGSTSEEIAGGTGLYPSTVREALAELNEEGNVSREKRESEGAGNNPYEYTAIAP
SELVGGIVHQVQDELNTVFNLDQYLTEDGSEASRPITITVDDTDDEGEDDGDDAEEVEK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaaacgacccagacgacggcgaggagatcccggtgacgatcgacacggaggag
ggaacggacgcccgcacgcgaatcggggagggcgccgaccgcgcggtcgaggagttcgat
aaggggatcgtcgacctgctggcgtgggtgctcgacaccgaaacgcgcgcgcggatctac
gtctacctccggcagtaccccggctcgaccagcgaggagattgccggggggacgggtctg
tatccgagcaccgtccgcgaggcgcttgcggaactcaacgaggagggcaacgtctcccgc
gaaaagcgagagagcgagggcgcgggcaacaacccctacgagtacaccgcgatcgcgcca
agcgaactcgtcggcgggatcgttcatcaggttcaggacgaactcaacaccgtcttcaac
ctcgaccagtacctcacggaggatggaagcgaggcgagtcggccgatcaccatcaccgtc
gacgacaccgacgatgagggtgaggacgacggcgacgacgcggaggaagtcgagaagtag

DBGET integrated database retrieval system