KEGG   Halalkalicoccus jeotgali: HacjB3_07860Help
Entry
HacjB3_07860      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trep_Strep SOP4
Motif
Other DBs
NCBI-ProteinID: ADJ14957
UniProt: D8J2K0
Position
complement(1457408..1457650)
Genome map
AA seq 80 aa AA seqDB search
MFTSALFFSILYVYNGAAGGFSSASWLLFMVVGTVLSGIAESLLAGRWRAAGLLRVIAVL
VLLSMLAIVVFAPDLIVGGR
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgttcacgagcgcgctcttcttttcgatcctctacgtctataacggggcggccggtggg
ttctcatcggccagttggttgttgttcatggtcgttgggaccgttctgtcgggtattgcc
gagtcccttctggcgggccgatggcgagcggccggtctactgcgtgtcatagcggttctc
gtgttgttgtccatgctggcaatcgtcgtcttcgcacccgatctcattgttgggggccgg
tag

DBGET integrated database retrieval system