KEGG   Halalkalicoccus jeotgali: HacjB3_07865Help
Entry
HacjB3_07865      CDS       T01271                                 

Definition
(GenBank) Gluconate transporter
  KO
K03299  gluconate:H+ symporter, GntP family
Organism
hje  Halalkalicoccus jeotgali
Brite
KEGG Orthology (KO) [BR:hje00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hje02000]
    HacjB3_07865
Transporters [BR:hje02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   HacjB3_07865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GntP_permease CitMHS RbcS
Motif
Other DBs
NCBI-ProteinID: ADJ14958
UniProt: D8J2K1
Position
complement(1458012..1459400)
Genome map
AA seq 462 aa AA seqDB search
MFDATVLQLGGQGPLVSLLAGIVAIIIMLIVFDLPPFIALVVSGLVVGIVTPQIVFGEVP
AEFATAFGNNMAGIGIPILMAAVIGKSMIESGAADRIVRGFNSLFGEGRSEISLFGSSFV
IAIPVFFDNVFYLLAPLARAARSRTGGDYTLFIVAMGVAGATTHGFVPPTPGPLLAAAEV
GANLGTTILVGILVGLPTALVAGLGYGHFINRRLDIPLRDAMGTDVEELEEKVSRPTSAL
PGLFESLLPILLAVLLVAANTGVETYLGEESGAASITGFFGDPNFSLTIAALAAAFTFYR
MSDLTEETFSDELTEALKSGGNIAAITAAGGAFGAMLAAAGAGEYIASGLENIGFGLLVT
AWVIAAGVRLVQGSATVAIVTTAGIVAPFTGQLTVNTAYLVMVIGAGATFCSWYNDSGFW
IVKEIGGLTQAETLKTWTVATILIGVVGLLATLVISTVLPLA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacgctaccgtactgcagttaggtgggcaggggcccctcgtttcgctcctggca
ggaatcgtagcgatcatcatcatgttgatcgtcttcgacttgcccccgtttatcgcgctg
gtcgtctcggggctggtcgtcggaatcgtcacaccacagatcgtcttcggcgaggtgccc
gccgagttcgccacagcgttcgggaacaacatggccgggatcgggatcccgatcctgatg
gcggcggtcatcggcaagtcgatgatcgaaagcggggccgctgatcgcatcgtccgcggg
ttcaattcattgttcggggagggccgatccgaaatctcgctgttcgggagcagtttcgtg
atcgcgatcccggtgtttttcgacaacgtcttttacctgctcgcgccgctggcgcgggct
gcccgttcccggacgggcggggactacacgctgtttatcgtcgccatgggcgtggccggt
gcgaccacccacgggttcgttccgccgacgcccggcccgctgctggcggccgccgaggtc
ggtgccaacctcgggacgacgatcctcgtcgggattctggtcgggctcccgaccgcgctc
gtcgccgggctcggctacgggcacttcatcaatcgccggctcgacatcccgctgcgcgat
gcgatggggaccgacgtcgaggaactcgaagagaaggtcagcaggccgaccagcgccctt
ccggggctgttcgagtcgctgcttccgatcctgctcgcggtcctgctcgtggccgcgaat
acgggcgtcgagacgtacctcggtgaggagagcggggccgcaagtatcacgggctttttc
ggcgatccgaacttctcgctgacgatcgccgcgctggcggcggcgtttacgttctaccgg
atgagcgacctcaccgaggagaccttctctgacgaactcacggaggcgctcaaaagcggt
ggaaacatcgccgcgatcaccgccgccggtggtgcattcggggcgatgctggctgcggcg
ggcgcgggcgagtacatcgcgagcgggctagagaacatcgggttcgggctgctcgtgacc
gcgtgggtgatcgccgccggcgtgcgcctcgtccaggggtcggcgacggtcgcgatcgtc
actacggccggcatcgtcgcaccctttaccggccaactgacggtcaacacggcctatctc
gtcatggtgatcggcgcgggcgctaccttctgctcgtggtacaacgattcgggcttctgg
atcgtcaaggagatcggggggctcacgcaggcggaaacccttaaaacgtggacggtggcg
acgatcctgatcggggtcgtcggtctgctggcgacgctggtcatctcgacggtgctgccg
cttgcctaa

DBGET integrated database retrieval system