KEGG   Halalkalicoccus jeotgali: HacjB3_07875Help
Entry
HacjB3_07875      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADJ14960
UniProt: D8J2K3
Position
complement(1460101..1460460)
Genome map
AA seq 119 aa AA seqDB search
MVLDTVIVFLISLLVGSLGIYVGVSLATNEAIGFGGATLTALAGALAWGLVSFFLGWLPL
VGALLALLAWVGVINLRHSGGWGTAALIGVVAWLVAGAVLYALAIGGLVSASAVGIPGV
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggtactcgataccgtgatcgtgttcctgatcagtttgctggtcgggagtctagggatc
tacgtcggggtcagtctcgcgacgaacgaggcgatcggcttcgggggagcgacgttgacc
gcgctggccggcgcgctcgcgtggggtctcgtgagtttctttctcggatggctcccgctg
gtgggcgcgctgttggcgcttctggcgtgggtcggcgtcatcaacctcagacactcgggc
gggtggggcacggcggctctgatcggggtcgtcgcgtggctcgtcgccggggccgtgctc
tacgcgctcgcgatcggggggctggtttcggcctcggcggtcggaatcccgggggtctga

DBGET integrated database retrieval system