KEGG   Halalkalicoccus jeotgali: HacjB3_07885Help
Entry
HacjB3_07885      CDS       T01271                                 

Definition
(GenBank) translation initiation factor Sui1
  KO
K03113  translation initiation factor 1
Organism
hje  Halalkalicoccus jeotgali
Brite
KEGG Orthology (KO) [BR:hje00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hje03012]
    HacjB3_07885
Translation factors [BR:hje03012]
 Eukaryotic Type
  Initiation factors
   eIF-1
    HacjB3_07885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SUI1 Img2
Motif
Other DBs
NCBI-ProteinID: ADJ14962
UniProt: D8J2K5
Position
complement(1461256..1461564)
Genome map
AA seq 102 aa AA seqDB search
MADDNDDGLGSVSGLPDELGIDDDLARADQRATVRVESRRYGKPMTLVEGLDPKAVDLTE
LASQLKRALAVGGTVEDDRIELQGEHAKRVPDLLRERGFEVA
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgacaacgacgacggactgggctcggtctcggggctcccggacgaactgggg
atcgacgacgatctggcgcgggccgatcagcgcgcgacggtccgtgtcgagtcccggcgc
tacggcaagccgatgacgctcgtcgagggattggatccgaaagcggtcgatctgacggaa
ctcgcctcccagctcaagcgcgcgctcgccgtcgggggaaccgtcgaggacgaccggatc
gaactacagggcgagcacgcgaaacgcgttcccgacctgctgcgcgagcgcgggttcgag
gtggcctaa

DBGET integrated database retrieval system