KEGG   Halalkalicoccus jeotgali: HacjB3_07925Help
Entry
HacjB3_07925      CDS       T01271                                 

Definition
(GenBank) adenylyl cyclase CyaB
  KO
K05873  adenylate cyclase, class 2 [EC:4.6.1.1]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:hje00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HacjB3_07925
Enzymes [BR:hje01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     HacjB3_07925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CYTH
Motif
Other DBs
NCBI-ProteinID: ADJ14970
UniProt: D8J2L3
Position
complement(1469448..1470101)
Genome map
AA seq 217 aa AA seqDB search
MLTGNATATGSGRPDGVGRDEPIGSGAFFEPPVVGGGVYEVEMKVRADHERVRAALNDRG
ATARDAVTQRDTYYDAPTRSFAETDEALRIRRETRKDTERAVLTYKGPLVGENSKTREEH
ETGVEDGEIVGSILDSLGFVPVETVEKDREHFSLGEYVVTLDSIAGLGEFVEVETEVPEA
EIDSARDGVARTVESLGLDPAAEIQTSYLELLLDDAQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccgggaatgcgaccgccacgggtagtggacgaccggatggagtcggccgagac
gagccgatcgggagcggggcgtttttcgagcccccggtcgttggagggggcgtgtacgaa
gtcgagatgaaggtccgggccgatcacgaacgggtgcgggccgccttgaacgatcggggt
gcgaccgcccgcgatgcggtcacacagcgggacacgtactacgacgcgccgacgcggagt
ttcgccgaaaccgacgaagcgcttcgtatccgccgcgagacacggaaggataccgaacga
gcggtgctcacgtacaaggggccgttggtcggcgagaactcgaagacacgtgaggaacac
gagacgggtgtcgaggacggcgaaatcgtgggatcgatcctcgattcgttggggttcgtc
cccgtcgagaccgtcgagaaggaccgcgagcacttctcgctcggggagtacgtcgtcacg
ctcgattcgatcgccggcctgggcgagttcgtcgaggtcgaaaccgaggtccccgaggcc
gagatcgacagcgcacgcgatggcgtcgcccggacggtcgagtcgctcggactcgatccc
gcggcggagattcagacctcgtatctcgagctgctgctcgatgatgcgcagtaa

DBGET integrated database retrieval system