KEGG   Halalkalicoccus jeotgali: HacjB3_08015Help
Entry
HacjB3_08015      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-CSL zf_UBZ Zn-ribbon_8 DUF35_N zf-NADH-PPase DZR zf-ribbon_3 zf-LITAF-like zf-RING_7 Methyltransf_13 Lar_restr_allev HypA
Motif
Other DBs
NCBI-ProteinID: ADJ14988
UniProt: D8J2N1
Position
complement(1483909..1484037)
Genome map
AA seq 42 aa AA seqDB search
MPTCGRCGGEFAAEELTRHENGPLLVVHCPDCGRVLGRYRRR
NT seq 129 nt NT seq  +upstreamnt  +downstreamnt
atgccgacctgcggacgctgtgggggcgagttcgccgccgaggagctgacgcgccacgag
aacggcccgctgttggtcgttcactgtccggactgcgggcgggttctggggcgctatcga
cgccgctga

DBGET integrated database retrieval system