KEGG   Halalkalicoccus jeotgali: HacjB3_08050Help
Entry
HacjB3_08050      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_12 Methyltransf_23 Rsm22
Motif
Other DBs
NCBI-ProteinID: ADJ14995
UniProt: D8J2N8
Position
complement(1489176..1490639)
Genome map
AA seq 487 aa AA seqDB search
MNRRAVLDAAKYLRNVRPIDPEEVCEYVEGGAHPAVVRRTLREEALSLGLTEREDGTFVP
ASEGPLSPASEGVYALPDRYLARLEDLLIERFGPDWPDGESGAALREAIRRLKERYYRQH
PVEYDEEAALGYAIYHLPDYYAATGYVLDELGSRGLLPARLRVLDVGAGVGGPALALAEY
ATDALVEYHAIEPSAAADVLEGVLAETPRNFHPTIHRRSAEAFEPDGVFALDTDGQRESD
GSRAGYDLLLFANVLSELSEPAAVLRKYLTHLVSGGAALALSPADKNTATGLRAVEHEVV
AGSEYTVFAPTLRLWPDREPTDHCWSFERKPDLDLPGLQRRLDEGKRADRERGERDAATG
EFLNRDVQYAYSILRRDGRRRIDATANPERFAPFADSEAHVTDRIDCIAVKLSRSLSESR
PLFLLGDGSQSESHYAVLTRETGLNRALSEADYGDVLVFESALVLWNDDEGAYNLVIDEE
CIVDRVG
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggcgggcagtcctcgacgccgcgaagtacctccggaacgtccggcccatcgat
cccgaggaggtctgcgagtacgtcgagggcggcgcccatcccgcggtcgttcggcggacg
ctgcgtgaggaagcgctctcgctcggcctgaccgaacgcgaggacgggactttcgtcccc
gcgagcgaggggccgctctcgcccgcctccgagggagtgtacgcgcttcccgatcggtat
ctcgcccgcctcgaggacctcctgatcgagcgcttcggccccgactggcccgacggcgag
agcggggccgctctcagggaggcgatccgccgactcaaggagcgctactaccgccaacac
cccgtcgagtacgacgaggaggcggcgctgggatacgcgatctaccacctgccggattac
tacgcggcgaccgggtacgtcctcgacgaactgggttcgcgcggcctgcttcccgcgagg
ctgcgcgtactcgacgtgggtgcgggcgtcggtggaccggcgctggcactcgcggagtac
gccacggacgcgctcgtggagtatcacgcgatcgaacccagcgcggccgccgacgtcctg
gagggggtgctcgcggagacaccccgaaacttccacccgacgatccaccggcgcagcgcc
gaggccttcgagcccgacggcgtcttcgccctggacacggacggccagcgcgaatcggac
gggtcccgcgccgggtacgacctgctcctgttcgcgaacgtgctgagcgaactctccgaa
cccgcggcggtcctgcggaagtacctcacacacctcgtttccggtggagcggccctcgcg
ctctcgccggccgataagaacaccgcgaccggcctgcgggcggtcgaacacgaggtcgtc
gcgggaagcgagtacaccgtcttcgcgccgaccctgcggctgtggcccgaccgcgagccg
accgaccactgctggtcgttcgagcgcaagcccgatctggacctcccgggactccagcgc
cgcctcgacgagggcaaacgcgccgaccgcgagcgcggcgagcgcgacgccgccaccggc
gagttcctcaatcgggacgtccagtacgcctactcgatcctccgacgggacggccgtcgg
cggatcgacgccaccgccaatcccgagcgctttgcccccttcgccgacagcgaggcccac
gtcaccgaccggatcgactgcatcgcggtcaaactcagtcgctcgctctcggagtccagg
cccctgttcttgctgggcgacgggagccaatcggagagtcactacgccgtactcacacgg
gaaacagggctgaaccgcgcgctttccgaggccgactacggcgacgtactcgtcttcgaa
tccgcgctggtgctgtggaacgacgacgagggcgcgtacaacctcgtgatcgacgaggag
tgtatcgtcgaccgggtcggataa

DBGET integrated database retrieval system