KEGG   Halalkalicoccus jeotgali: HacjB3_08140Help
Entry
HacjB3_08140      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_33 PAXNEB
Motif
Other DBs
NCBI-ProteinID: ADJ15013
UniProt: D8J2Q6
Position
complement(1506479..1507093)
Genome map
AA seq 204 aa AA seqDB search
MCVPARLGDLVESAPAGSAFLLSGPPMTGKYDLLVGLLSATDAIVVTTDTDESTVRDDYR
EWAGSGTLSVVDCASRSRGVETPDSEDVRYVSDPGNLTRVGTAFTDLLDRRSGTTGRVGL
HSISPLLVYADLRSVYRFLQVFTGQVRSSGWSCFATFDPTMHDEQATNTVLDPFDARIET
RETDGRREARVAGLDPNASEWMAF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgttccagcgcggctgggggatctcgtcgagtcggctcctgccggttccgcgttc
ttgctctcggggcctccgatgaccgggaaatacgacctgctcgtcgggttgctctcggcg
accgacgcgatcgtcgtgacgaccgacacggacgagtcgaccgtcagggatgactaccgg
gagtgggccgggtccggaacgctctcggtcgtcgactgtgcgagccgttcccgtggggtc
gagacccccgactccgaggacgttcgctacgtgtcggatccggggaacctgacgcgggtc
ggtaccgcctttaccgacctcctcgatcgccgttccgggactacgggacgggtggggcta
cactcgatctcgccgctgttggtctacgcggatctccgctctgtctaccggtttctacag
gttttcaccgggcaggtccgcagttcggggtggtcgtgtttcgcgacgttcgacccgacg
atgcacgacgagcaagcgacgaatacggttctcgatccgttcgacgcccgcattgagacc
cgcgagaccgacggccggcgggaggcacgagtcgcggggctcgacccgaacgccagcgag
tggatggcgttttag

DBGET integrated database retrieval system