KEGG   Halalkalicoccus jeotgali: HacjB3_08185Help
Entry
HacjB3_08185      CDS       T01271                                 

Definition
(GenBank) fla cluster protein flaG
  KO
K07330  archaeal flagellar protein FlaG
Organism
hje  Halalkalicoccus jeotgali
Brite
KEGG Orthology (KO) [BR:hje00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hje02044]
    HacjB3_08185
   02035 Bacterial motility proteins [BR:hje02035]
    HacjB3_08185
Secretion system [BR:hje02044]
 Type II secretion system
  Archaeal flagellar protein
   HacjB3_08185
Bacterial motility proteins [BR:hje02035]
 Flagellar system
  Archaeal flagellar proteins
   HacjB3_08185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arch_flagellin CARDB DUF3324
Motif
Other DBs
NCBI-ProteinID: ADJ15020
UniProt: D8J2R3
Position
complement(1512276..1512731)
Genome map
AA seq 151 aa AA seqDB search
MGSVSISHLIIFIASLLVAASVAGTLVTGVEQVSSSVDRQSEDITRQIDTDVAIISDPSS
DAVYDEQAETVSLLVKNTGRTPIEANGSSLDTLIDGQYRSGPTVTVVSGESRWSPGAVAT
VTVPVEGGLDAGDHRATVIVNGSRATFDFRF
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggtctcgatctcgcacctgatcatcttcatcgcgagcctgctggtcgcggcc
agcgtcgccggcacgctggtgacgggtgtcgagcaggtcagtagctccgtcgatcgccag
agcgaggacatcacccggcagatcgacaccgacgtcgcgatcatcagcgacccgtcgagc
gacgcggtctacgacgagcaagcggaaacggtctccctgctggtgaaaaacaccggccgg
acgcccatcgaggcgaacgggtcgtccctcgacacactgatcgacggccagtaccggtcg
ggaccgaccgtcacggtcgtctccggggagagtcgatggtcgccgggggcggtcgcgacg
gtgacggtccccgtcgagggcggcctcgatgccggcgatcaccgcgcgacggtcatcgtc
aacggcagtcgggcgacgttcgacttccggttctga

DBGET integrated database retrieval system