KEGG   Halalkalicoccus jeotgali: HacjB3_08210Help
Entry
HacjB3_08210      CDS       T01271                                 

Gene name
btuC
Definition
(GenBank) corrinoid ABC transporter permease
  KO
K02015  iron complex transport system permease protein
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje02010  ABC transporters
Module
hje_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:hje00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HacjB3_08210 (btuC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hje02000]
    HacjB3_08210 (btuC)
Transporters [BR:hje02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    HacjB3_08210 (btuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD ABC-3
Motif
Other DBs
NCBI-ProteinID: ADJ15025
UniProt: D8J2R8
Position
complement(1515980..1517047)
Genome map
AA seq 355 aa AA seqDB search
MGAWSAGLSCLLVCVVLFSAAFGPVRVAPLVVAEVLLNAVALPVGIEPAGATGVGPLSIP
LPRLEWASVFDFAVPATHETIVMRIRLPRVVLAATVGFALAAAGTVMQGFFRNPMADPSI
VGVSSGAALGAVASIVLPLPLGLRPMAFLCAILTAFAVYLIASEGGRTPVATLLLAGVAI
QTFLGAMISYLQLSAGESLEQVVYWLMGHLHASTWTDVRLSLPVVIPLFVLLVVYAGDLN
VLLLGEEDAQSLGIEVERTKRLLLAAASVITAAGVAVSGVIGFVGLIVPHVMRLLVGPDH
RILLPTSALAGSVFLVATDTVARAGPAEVPVGIVTAALGAPFFLYLLRTREVHAL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgtggtcggcgggtctttcctgtctgctggtctgtgtcgtgttgttcagcgcg
gcgttcggaccggtccgggtggctccgctcgtcgtggccgaggtgcttctcaacgcggtg
gcgctcccggtcgggatcgaaccggcgggtgcgaccggggtcggcccgctctcgattccg
ctcccccgactcgaatgggcgtcggtcttcgactttgcggtgcccgcaacccacgagacg
atcgtcatgcggatccggcttccgagggtggtgctcgcggcgacggtcggcttcgcgctt
gcggccgcggggacggtgatgcaggggttctttcgcaatccgatggccgatccctcgatc
gtcggcgtctcctcgggcgctgcgctcggtgcggtcgcttctatcgtcctcccgctcccg
cttgggttgcgcccgatggcgtttctctgtgcgatcctcaccgctttcgcggtctacttg
atcgccagcgagggcgggcgtacgccggttgcgaccctgctgcttgcgggcgtcgccatc
cagacgtttctgggcgcgatgatctcgtatctccagttgagcgccggcgagagcctcgaa
caggtcgtctactggctgatgggccacctgcacgcgagcacgtggaccgacgtgcgcctc
tcgttgccggtcgtgatcccgctgttcgtcctgctcgtagtgtacgcgggcgatctcaac
gtcctgcttctgggcgaggaggacgcccagagcctcgggatcgaggtcgagcggaccaag
cgactactgctcgccgcggcgagcgtcatcaccgctgcaggggtcgccgtctcgggggtg
atcggcttcgtggggctgatcgtcccccacgtgatgcgcctgctggtcgggcccgaccac
cggatcctgctcccgacgagcgcgctcgcgggcagcgtcttcctcgtcgcaaccgacacc
gtggcacgggccggccccgccgaggtgcccgtcgggatcgtcaccgccgcgctgggtgcg
cccttcttcctctatctgcttcgtactcgggaggtgcacgcgctgtga

DBGET integrated database retrieval system