KEGG   Halalkalicoccus jeotgali: HacjB3_08260Help
Entry
HacjB3_08260      CDS       T01271                                 

Definition
(GenBank) NUDIX hydrolase
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: ADJ15035
UniProt: D8J2S8
Position
1523606..1524067
Genome map
AA seq 153 aa AA seqDB search
METTRHFVATVYVVYGGATLLHEHRTLGLWLPPGGHLDRDELPHEAALREVREETGLDVE
LLTEHDGVRSPTVESLPEPAHLLLEDIDTYDGAVGHQHIDFVYYGRADSRTLDPGDGEQS
ADAWEWVTSEELDEERFDADVTRLGREAIGSVE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgacacgccacttcgtcgcgaccgtctacgtcgtctacggcggcgcgaccctg
ctgcacgaacaccggacgcttgggctgtggctcccgccgggcgggcacctcgaccgggac
gaactgccccacgaggcggccctgcgcgaggtgcgcgaggagacgggcctcgacgtagag
cttctgaccgaacacgacggcgtccgttccccgaccgtcgagtcgctgcccgaacccgcc
cacctgctgctcgaggacatcgacacctacgacggggcggtcggccaccagcacatcgat
ttcgtctactacggccgggcggactcgcgcacgctcgatcccggcgacggcgagcagtcc
gcagacgcgtgggagtgggtcacgagcgaagaactggacgaggagcgcttcgacgccgac
gtgacccggctgggccgggaggcgatcggctcagtcgagtag

DBGET integrated database retrieval system