KEGG   Halalkalicoccus jeotgali: HacjB3_08265Help
Entry
HacjB3_08265      CDS       T01271                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00250  Alanine, aspartate and glutamate metabolism
hje01100  Metabolic pathways
hje01110  Biosynthesis of secondary metabolites
hje01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hje00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HacjB3_08265
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hje01002]
    HacjB3_08265
Enzymes [BR:hje01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     HacjB3_08265
Peptidases [BR:hje01002]
 Cysteine Peptidases
  Family C44
   HacjB3_08265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: ADJ15036
UniProt: D8J2S9
Position
complement(1524056..1525111)
Genome map
AA seq 351 aa AA seqDB search
MIHGSDSALVERALEDRDPFPGTRGFAGDLPDGRLVRDVLGRVPLFVERTGEGWGFSPTA
LADPVPFPAGHVDDERVWTLPAPSPFAGEREAVAATEGAIGASLALDSDGLAVAFSGGVD
SAVVASRLEAPLYVVGFEGSHDIAAAREGASAMGRDLRVVECTHADIERAVPRVARATDR
TNAMDVGIALSLFLVAERAVADGFDRLAIGQGADELFGGYEKVVRTDHRVESDSVRGATR
EVIASLPDQLERDVLAIRAAGAEPVAPLLDDRVVRAALRLDGPMLATDEERKRVFREAAR
EFVPREVANREKKAMQYGSLIARELDRLARQAGFKRRMDDHVTKYVESLLD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgggagcgattccgcgctcgtcgaacgcgcactcgaggaccgcgatccgttc
cccgggacgcgagggttcgccggcgacctccccgacggcaggctcgtccgggacgttctc
gggcgcgttccgctgttcgtcgagcgcacgggtgaggggtggggattctcaccgaccgcc
ctcgcggatccggtcccgttcccggcgggtcacgtcgacgacgagcgcgtctggacgctt
cccgccccgtccccgttcgccggggagcgcgaggcggtcgcagcgaccgaaggtgcgatc
ggggcgagcctcgcgctcgattcggacggactcgcggtcgccttctcgggcggcgtcgac
tcggcggtcgtcgcgagtcgcctcgaagcacccctgtacgtcgtcggcttcgaggggagc
cacgacatcgccgcggcccgcgagggcgcgagcgcgatggggcgggatctccgggtcgtc
gagtgtacccacgccgacatcgagcgggcggtcccccgcgtggctcgcgcgacggaccgg
accaacgcgatggacgtggggatcgcgctgtcgctgtttctcgtcgccgagcgagccgtc
gcggacggcttcgaccgcctcgcgatcggccaaggcgccgacgagctgttcggcggctac
gagaaggtcgtccggaccgaccaccgagtcgaatccgactccgtgcgcggcgcgacccgc
gaggtgatcgcctcgctcccagaccaactggaacgtgacgttctcgcgatccgtgccgcc
ggcgccgaaccggtcgcacccctgctcgacgaccgggtggtgcgggcggctttgcgtctc
gacggcccgatgctcgcgaccgacgaggagcgaaaacgcgtcttccgggaggcggcccgc
gagttcgtcccccgcgaggtggcaaaccgggagaagaaggcgatgcagtacggcagcctg
atcgcgcgcgaactcgatcgcctcgcccggcaggcggggttcaaacgccgaatggacgac
cacgtcacgaagtacgtcgagtcgctactcgactga

DBGET integrated database retrieval system