KEGG   Halalkalicoccus jeotgali: HacjB3_08320Help
Entry
HacjB3_08320      CDS       T01271                                 

Definition
(GenBank) cysteine desulfurase
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADJ15047
UniProt: D8J2U0
Position
1533379..1534485
Genome map
AA seq 368 aa AA seqDB search
MTPEELRAETPGFENCTYLNTGASGPSPRRVVEAATGFLERHEYETPAGEGMYVAADAVY
EEAREAVAGLLNTDERRVALTQSTTDGINRIASAMDFEPGDVVVRTDLEHSAGILPWQRL
ADVHDLEIRILETREGRIDPEEYAEAVADARLACFSALTWTHGTRLPVRKLVEIAHDAGA
RTLVDAVQMPGQTGLDVEAWGADAVAAAGHKWLLGTWGAGFLAVSPDFLAELEPRSVGYR
SVAEPDAEAYAFHEGARRLEIGTTNPAPYAALTEAIETMDRVGYGRIESRIAGLTDRLKD
GLDEERLYSPREYESGLVTFADEDPEATVERLGEAGIRVRTLPGPEAIRASVHAINTEAD
VDALLEAL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgactcctgaggagcttcgcgccgagacgcccggcttcgagaactgcacctacctcaac
acgggcgcaagcggccccagcccccgccgagtcgtcgaggccgcgaccggctttctcgaa
cgccatgagtacgaaacgcccgccggtgaggggatgtacgtcgccgccgacgcggtctac
gaggaggcccgcgaggcggtggcaggtctgttgaacaccgacgagcgacgggtcgcgctg
acccagagcacgaccgacgggatcaaccggatcgcgagcgcgatggatttcgagcccggc
gacgtcgtggttcggactgacctcgaacactccgccggaatcctgccgtggcagcgactc
gcggacgttcacgacctcgaaatccggatcctcgaaacccgcgagggacggatcgatccc
gaagagtacgccgaggcggtcgcggacgcccggttggcctgtttcagcgcgctcacgtgg
acgcacgggacgcgactaccagtccgaaagctggtcgagatcgcccacgacgccggcgcg
cgcaccctggtcgatgccgtccagatgcccggacagacgggactggacgtcgaggcgtgg
ggcgcggacgcggtcgccgcggcggggcataagtggctgctcgggacgtggggtgcgggg
tttctcgccgtctcgcccgacttcctcgcggagctcgaaccccgatcggtgggctatcgc
agcgtggccgaaccggacgccgaggcctacgccttccacgagggggcccgtcgtctcgag
atcggcacgacgaaccccgcgccctacgccgcgctcaccgaggccatcgaaacgatggat
cgtgtggggtacggccggatcgaatcccggatcgccgggctgaccgaccggctcaaggac
gggctggacgaagagcgcctgtacagtccccgggagtacgagagcgggctggtcacgttc
gccgacgaggaccccgaggccacggtcgagcggctgggcgaggcggggatccgggtccgg
acgctcccgggcccggaggcgatccgcgcgtcggtccacgcgataaacaccgaggccgac
gtcgacgcgctactcgaggcgctctga

DBGET integrated database retrieval system