KEGG   Halalkalicoccus jeotgali: HacjB3_08425Help
Entry
HacjB3_08425      CDS       T01271                                 

Definition
(GenBank) formaldehyde dehydrogenase
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: ADJ15068
UniProt: D8J2W1
Position
complement(1555413..1556573)
Genome map
AA seq 386 aa AA seqDB search
MNAVVYQGPHDVAVEEVDEPEIEHPNDVVIDITTTCICGSDLHMYEGRTDAEPGIVFGHE
NMGIVDEVGEGVSTLEEGDRIVLPFNVACGFCQNCEAGYTGFCTNVNPGFAGGAYGYVAM
GPYKGGQAERLRVPYADFNALKLPEGDEHEDSFSLLADIFPTGWHGTELANLQPGESVAI
FGAGPVGAMAAYSAHIKGAAEIYTVDRVPSRLDAVEENCGAIPINFEDSDPVEQIKNEHG
GMVDKGVDAVGYQAIDPETDPSDDAYNPARENPAVVLNQLIQVVRPTGELGIPGLYVPSD
PGAPDEMAAQGRLGIDFGKFFEKGLKCGTGQCNVKQYNRALRDLIIEGRADPSWIVSHRV
GLDEAPEMYEAFDNREEGVTKVLLEP
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgtggtctatcagggaccgcacgacgtggcggtggaggaagtggacgaaccg
gagatcgagcaccccaatgacgtggtgatcgacatcacgacgacctgtatctgtggctcc
gacctccacatgtacgaggggcgcaccgacgccgagccggggatcgtcttcggccacgag
aacatggggatcgtcgacgaagtgggggagggcgtaagcaccctcgaagagggcgaccgg
atcgtcctcccgttcaacgtcgcctgtggattctgtcagaactgcgaggcgggctacacg
ggcttctgtacgaacgtcaaccccggtttcgcgggcggggcctacggttacgtcgcgatg
gggccctataagggcggacaggccgaacggctgcgggttccgtacgcggacttcaacgcg
ctgaagctccccgagggcgacgagcacgaggactcgttttcgcttctggccgatatcttc
ccgacaggctggcacgggaccgaactcgcgaacctccaaccaggggaatcggtcgcgatc
ttcggggccggccccgtcggcgcgatggccgcctacagcgcccacatcaagggtgccgcc
gagatctacactgtcgaccgggtgccgagccgactcgacgcggtcgaggagaactgcggg
gcgatcccgatcaacttcgaggactcggatccggtcgagcagatcaagaacgaacacggc
ggcatggtcgacaagggcgtcgacgccgtgggctatcaggcgatcgaccccgaaaccgac
ccctcggacgacgcctacaacccggcgagggagaaccccgccgtggtcctcaaccagctg
atccaagtcgttcgcccgaccggcgagctcgggatccccggactctacgtcccctcggat
cccggcgcgcccgacgagatggccgcacaggggcggttgggaatcgacttcgggaagttc
ttcgagaagggcctgaagtgtggcaccggccagtgtaacgtcaagcagtacaaccgcgcc
ctccgtgacctgatcatcgagggacgggcggacccgagctggatcgtctcccatcgtgtg
ggtctcgacgaggcccccgagatgtacgaggccttcgacaaccgcgaggagggcgttacg
aaggtcctgcttgaaccctga

DBGET integrated database retrieval system