KEGG   Halalkalicoccus jeotgali: HacjB3_08435Help
Entry
HacjB3_08435      CDS       T01271                                 

Definition
(GenBank) molybdopterin-guanine dinucleotide biosynthesis protein A
  KO
K03752  molybdenum cofactor guanylyltransferase [EC:2.7.7.77]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00790  Folate biosynthesis
hje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hje00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HacjB3_08435
Enzymes [BR:hje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.77  molybdenum cofactor guanylyltransferase
     HacjB3_08435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADJ15070
UniProt: D8J2W3
Position
complement(1557413..1558024)
Genome map
AA seq 203 aa AA seqDB search
MPDGVVLAGGRSTRFGETDKATADLGGTPMIRRVGDRLEGATDRLVVNCRADQTAAIKAA
FEGYSNPLVVAEDPDPDEGPMAGIRTGLRDTESEYAFVAACDMPFVEPALVAHLFERAHG
YDAAVPRVGDGWFQPTHAVYRTESMVEACERALAAGERKVIAPLEYLEYVVIGESEVLEY
ALLKTFENLNTREEFEEALKRLE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgccagacggcgtcgtcctcgccggcggtcgctcgacccgcttcggcgagacggacaag
gccactgccgacctcggaggcacgccgatgatccgtcgggtcggcgaccgcctcgaaggc
gcgaccgaccggttggtcgtgaactgccgggccgaccagacggcggccatcaaggcggcc
ttcgagggctactcgaacccgctcgtcgtcgcagaggatcccgatcctgacgaagggccg
atggcggggatccggacgggacttcgagataccgaaagcgagtacgccttcgtcgcggct
tgcgatatgcccttcgtcgagcccgcgctcgtcgcacacctcttcgagcgcgcccacggg
tacgacgccgccgtccctcgggtgggcgacggctggtttcaacccacccacgccgtctac
cggaccgaatcgatggtcgaggcctgcgaacgcgcgctcgcggcgggcgagcggaaggtg
atcgcacccctcgagtatctggagtacgtcgtgatcggcgagtccgaggtcctcgagtac
gccctattgaagaccttcgagaacctcaacacccgcgaggagttcgaggaggcgctcaag
cgcctcgaatga

DBGET integrated database retrieval system