KEGG   Halalkalicoccus jeotgali: HacjB3_08455Help
Entry
HacjB3_08455      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
  KO
K03795  sirohydrochlorin cobaltochelatase [EC:4.99.1.3]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00860  Porphyrin and chlorophyll metabolism
hje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hje00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HacjB3_08455
Enzymes [BR:hje01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.3  sirohydrochlorin cobaltochelatase
     HacjB3_08455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiX CbiK
Motif
Other DBs
NCBI-ProteinID: ADJ15074
UniProt: D8J2W7
Position
complement(1559967..1560833)
Genome map
AA seq 288 aa AA seqDB search
MQALVIVGHGSHLNPGSSRPTFSHADTIRETGVFDEVREAFWKEEPSFREVLRTLESDEV
YVVPLFISEGYFTEQVIPRELRLEGWDVSAWESGDGVSADHATLKASDVEKTIHYCGPAG
THDSMSDVIVRRAESVTGDSEVGDGFGLAIVGHGTERNENSAKAIEYHTDRIRESGRFDE
VRALFMDEEPEVDDVTDFFSTTDIVVVPLFIADGFHTQEDIPEDMGLTEDYRRGYDVPAE
VDGHRIWYSGAVGTESLMADVLLERAAEAGADVRGLSDGDASRGVADD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgctcgtcatcgtcggccacgggtcacacctcaatcccggttcatcgagaccg
accttctcacatgcggatacgatccgcgaaacgggggtcttcgacgaggttcgcgaggcg
ttctggaaggaagagccctcctttcgggaggtgcttcgcaccctcgaaagcgacgaggtc
tacgtcgtcccgctctttatcagcgagggctacttcaccgagcaggtgatcccccgcgag
ctccgcctcgaaggctgggacgtctcggcgtgggagtcgggcgacggcgtcagtgcggat
cacgccacgctgaaagccagcgacgtcgagaagacgatccactactgcgggccggcgggc
acccacgactcgatgagcgacgtgatcgtgcggcgcgcggagtcggtcaccggcgactcc
gaggtcggcgacgggttcggcctcgcgatcgtcggccacggcaccgagcgaaacgagaac
agcgcgaaagccatcgagtaccacaccgaccggatccgcgagtcgggccggttcgacgag
gtgcgggcgctgttcatggacgaggagcccgaagtcgacgacgtcaccgacttcttctcc
acgacggacatcgtcgtcgtccccctgtttatcgccgacggctttcacacccaggaggac
atccccgaggacatgggcctgaccgaggactaccggaggggctatgacgtccccgcggag
gtcgacggccaccggatctggtactcgggcgcggtcggcaccgagtcgctgatggccgac
gtgctgttggaacgggccgccgaagccggcgcggacgtacgcggtctgtccgacggcgac
gcgagtcggggggttgcggacgactga

DBGET integrated database retrieval system