KEGG   Halalkalicoccus jeotgali: HacjB3_08875Help
Entry
HacjB3_08875      CDS       T01271                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00020  Citrate cycle (TCA cycle)
hje00190  Oxidative phosphorylation
hje00650  Butanoate metabolism
hje00720  Carbon fixation pathways in prokaryotes
hje01100  Metabolic pathways
hje01110  Biosynthesis of secondary metabolites
hje01120  Microbial metabolism in diverse environments
hje01130  Biosynthesis of antibiotics
hje01200  Carbon metabolism
Module
hje_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hje_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hje_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HacjB3_08875
   00650 Butanoate metabolism
    HacjB3_08875
  Energy metabolism
   00190 Oxidative phosphorylation
    HacjB3_08875
   00720 Carbon fixation pathways in prokaryotes
    HacjB3_08875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ADJ15158
UniProt: D8J351
Position
complement(1634681..1635049)
Genome map
AA seq 122 aa AA seqDB search
MAERYSSFKPGGTLWLLQRVTAAFLVLVLAFHFFLLHFVNHASEITFAGSQYRMGTLSYY
SLMVTFLITATFHGVNGVYNALVNQGLDGTQKTAVKGVLIVASVLLIAQGIRTANAFAGI
TF
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcgctactcttcgttcaagcccggcggcaccctctggttgctccagcgcgtg
acggcggcgtttctggtcctcgtactggcgtttcacttcttcctccttcacttcgtgaac
cacgcctcggagatcaccttcgcgggcagccagtaccgcatgggaacgctgagctactac
tcattgatggtgacgtttctgatcaccgcgacgttccacggcgtcaacggcgtctacaac
gccctggtcaatcaggggctcgacggcacccagaagaccgccgtcaagggcgtgttgatc
gtcgcgagcgtactgctgatcgctcaggggattcgaacggcaaacgcattcgcagggatt
acgttctaa

DBGET integrated database retrieval system